Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH46_RS10935 | Genome accession | NZ_CP035234 |
| Coordinates | 496408..496542 (+) | Length | 44 a.a. |
| NCBI ID | WP_128903586.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1902277 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 491408..501542
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH46_RS02445 (EQH46_02600) | - | 491601..492962 (-) | 1362 | WP_001069067.1 | bacteriocin secretion accessory protein | - |
| EQH46_RS02450 (EQH46_02605) | comA/nlmT | 492973..495126 (-) | 2154 | WP_000205168.1 | peptide cleavage/export ABC transporter BlpA | Regulator |
| EQH46_RS02455 (EQH46_02610) | blpI | 495407..495604 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| EQH46_RS02460 (EQH46_02620) | blpJ | 496070..496339 (+) | 270 | WP_001093249.1 | bacteriocin-like peptide BlpJ | - |
| EQH46_RS10935 (EQH46_02625) | cipB | 496408..496542 (+) | 135 | WP_128903586.1 | bacteriocin class II family protein | Regulator |
| EQH46_RS02465 | - | 496479..496637 (+) | 159 | WP_001849862.1 | hypothetical protein | - |
| EQH46_RS02470 (EQH46_02630) | - | 496640..496759 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| EQH46_RS02475 (EQH46_02635) | - | 497056..497220 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| EQH46_RS02480 (EQH46_02640) | - | 497217..497621 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| EQH46_RS02485 (EQH46_02645) | - | 497824..498628 (+) | 805 | WP_128903587.1 | IS5 family transposase | - |
| EQH46_RS02490 (EQH46_02650) | blpM | 498778..499032 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH46_RS02495 (EQH46_02655) | blpN | 499048..499251 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH46_RS02500 (EQH46_02665) | cipB | 499495..499644 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH46_RS11060 | - | 499680..499745 (+) | 66 | Protein_501 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| EQH46_RS02505 (EQH46_02670) | - | 499748..499867 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH46_RS02510 (EQH46_02680) | - | 500653..501036 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 44 a.a. Molecular weight: 5055.79 Da Isoelectric Point: 3.6910
>NTDB_id=294875 EQH46_RS10935 WP_128903586.1 496408..496542(+) (cipB) [Streptococcus pneumoniae strain TVO_1902277]
MDTKMMSQFSVMDTEMLACVEGGGCNWEILPKQVLEEQQQEVFN
MDTKMMSQFSVMDTEMLACVEGGGCNWEILPKQVLEEQQQEVFN
Nucleotide
Download Length: 135 bp
>NTDB_id=294875 EQH46_RS10935 WP_128903586.1 496408..496542(+) (cipB) [Streptococcus pneumoniae strain TVO_1902277]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATACTGAAATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGAGATTTTGCCAAAGCAGGTGTTGGAGGAGCAGCAGCAAGAGGTCTTCAACTAG
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATACTGAAATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGAGATTTTGCCAAAGCAGGTGTTGGAGGAGCAGCAGCAAGAGGTCTTCAACTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
43.59 |
88.636 |
0.386 |