Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   EQZ01_RS16480 Genome accession   NZ_CP035231
Coordinates   3138346..3138513 (-) Length   55 a.a.
NCBI ID   WP_100505762.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103571     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3133346..3143513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQZ01_RS16450 (EQZ01_16450) mrpE 3133741..3134217 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  EQZ01_RS16455 (EQZ01_16455) mrpF 3134217..3134501 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  EQZ01_RS16460 (EQZ01_16460) mnhG 3134485..3134859 (+) 375 WP_128738180.1 monovalent cation/H(+) antiporter subunit G -
  EQZ01_RS16465 (EQZ01_16465) yuxO 3134898..3135278 (-) 381 WP_071579112.1 hotdog fold thioesterase -
  EQZ01_RS16470 (EQZ01_16470) comA 3135297..3135941 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQZ01_RS16475 (EQZ01_16475) comP 3136022..3138331 (-) 2310 WP_128738181.1 two-component system sensor histidine kinase ComP Regulator
  EQZ01_RS16480 (EQZ01_16480) comX 3138346..3138513 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  EQZ01_RS16485 (EQZ01_16485) comQ 3138497..3139399 (-) 903 WP_128738182.1 polyprenyl synthetase family protein Regulator
  EQZ01_RS16490 (EQZ01_16490) degQ 3139584..3139724 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQZ01_RS16495 (EQZ01_16495) - 3139946..3140071 (+) 126 WP_003228793.1 hypothetical protein -
  EQZ01_RS16500 (EQZ01_16500) - 3140185..3140553 (+) 369 WP_116315920.1 hypothetical protein -
  EQZ01_RS16505 (EQZ01_16505) pdeH 3140529..3141758 (-) 1230 WP_128738183.1 cyclic di-GMP phosphodiesterase -
  EQZ01_RS16510 (EQZ01_16510) pncB 3141895..3143367 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6505.42 Da        Isoelectric Point: 4.3494

>NTDB_id=294730 EQZ01_RS16480 WP_100505762.1 3138346..3138513(-) (comX) [Bacillus subtilis strain SRCM103571]
MQDLINYFLNYPEVLKKLKNKEACLIGFDVQETETIIKAYNDYYLSGPITREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=294730 EQZ01_RS16480 WP_100505762.1 3138346..3138513(-) (comX) [Bacillus subtilis strain SRCM103571]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGTTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACAGAAACAATAATTAAAGCTTATAATGATTATTATTTGTCTGGCCCAATAACCCGTGAATGGG
ATGGTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

92.453

96.364

0.891