Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EQY76_RS16540 Genome accession   NZ_CP035230
Coordinates   3091478..3091618 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103551     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3086478..3096618
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQY76_RS16515 (EQY76_16515) yuxO 3086755..3087135 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  EQY76_RS16520 (EQY76_16520) comA 3087154..3087798 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQY76_RS16525 (EQY76_16525) comP 3087879..3090191 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  EQY76_RS16530 (EQY76_16530) comX 3090207..3090428 (-) 222 WP_014480704.1 competence pheromone ComX -
  EQY76_RS16535 (EQY76_16535) comQ 3090430..3091293 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  EQY76_RS16540 (EQY76_16540) degQ 3091478..3091618 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQY76_RS16545 (EQY76_16545) - 3091840..3091965 (+) 126 WP_003228793.1 hypothetical protein -
  EQY76_RS16550 (EQY76_16550) - 3092080..3092448 (+) 369 WP_046381300.1 hypothetical protein -
  EQY76_RS16555 (EQY76_16555) pdeH 3092424..3093653 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  EQY76_RS16560 (EQY76_16560) pncB 3093790..3095262 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQY76_RS16565 (EQY76_16565) pncA 3095278..3095829 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  EQY76_RS16570 (EQY76_16570) yueI 3095926..3096324 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=294582 EQY76_RS16540 WP_003220708.1 3091478..3091618(-) (degQ) [Bacillus subtilis strain SRCM103551]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=294582 EQY76_RS16540 WP_003220708.1 3091478..3091618(-) (degQ) [Bacillus subtilis strain SRCM103551]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1