Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   DMB88_RS20110 Genome accession   NZ_CP029639
Coordinates   4424635..4425069 (-) Length   144 a.a.
NCBI ID   WP_254438660.1    Uniprot ID   -
Organism   Paenibacillus sp. DCT19 isolate rhisosphere     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4425246..4463106 4424635..4425069 flank 177


Gene organization within MGE regions


Location: 4424635..4463106
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DMB88_RS20110 nucA/comI 4424635..4425069 (-) 435 WP_254438660.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  DMB88_RS20115 - 4425246..4425752 (+) 507 WP_254438266.1 Ltp family lipoprotein -
  DMB88_RS20120 - 4425771..4425974 (+) 204 WP_128102774.1 hypothetical protein -
  DMB88_RS20125 - 4426130..4426942 (+) 813 WP_128102775.1 DNA-binding protein -
  DMB88_RS20130 - 4427003..4427728 (-) 726 WP_128102776.1 N-acetylmuramoyl-L-alanine amidase -
  DMB88_RS20135 - 4427721..4428122 (-) 402 WP_128104525.1 holin family protein -
  DMB88_RS31775 - 4428230..4428361 (-) 132 WP_302476274.1 hypothetical protein -
  DMB88_RS20140 - 4428409..4428696 (-) 288 WP_128102777.1 hypothetical protein -
  DMB88_RS20145 - 4428708..4429754 (-) 1047 WP_128102778.1 tail fiber protein -
  DMB88_RS20150 - 4429769..4430410 (-) 642 WP_128102779.1 hypothetical protein -
  DMB88_RS31445 - 4430394..4430960 (-) 567 WP_254438267.1 hypothetical protein -
  DMB88_RS31450 - 4430924..4431580 (-) 657 WP_254438268.1 baseplate J/gp47 family protein -
  DMB88_RS20160 - 4431581..4431934 (-) 354 WP_128102780.1 DUF2634 domain-containing protein -
  DMB88_RS20165 - 4431916..4432311 (-) 396 WP_128102781.1 Gp138 family membrane-puncturing spike protein -
  DMB88_RS20170 - 4432308..4433099 (-) 792 WP_128102782.1 hypothetical protein -
  DMB88_RS20175 - 4433089..4433418 (-) 330 WP_128102783.1 hypothetical protein -
  DMB88_RS20180 - 4433432..4433974 (-) 543 WP_128102784.1 phage baseplate protein -
  DMB88_RS20185 - 4433974..4436346 (-) 2373 WP_128102785.1 phage tail tape measure protein -
  DMB88_RS20190 - 4436391..4436579 (-) 189 WP_128102786.1 hypothetical protein -
  DMB88_RS20195 - 4436551..4436850 (-) 300 WP_128102787.1 hypothetical protein -
  DMB88_RS20200 - 4436882..4437280 (-) 399 WP_128102788.1 phage protein -
  DMB88_RS20205 - 4437296..4438300 (-) 1005 WP_254438269.1 DUF3383 family protein -
  DMB88_RS20210 - 4438293..4438781 (-) 489 WP_128102790.1 hypothetical protein -
  DMB88_RS20215 - 4438768..4439115 (-) 348 WP_128102791.1 hypothetical protein -
  DMB88_RS20220 - 4439118..4439591 (-) 474 WP_128102792.1 hypothetical protein -
  DMB88_RS20225 - 4439600..4440142 (-) 543 WP_128102793.1 phage head-tail connector protein -
  DMB88_RS20230 - 4440117..4440386 (-) 270 WP_128102794.1 hypothetical protein -
  DMB88_RS32165 - 4440440..4441788 (-) 1349 Protein_4105 phage major capsid protein -
  DMB88_RS30495 - 4441785..4442522 (-) 738 WP_174715307.1 head maturation protease, ClpP-related -
  DMB88_RS30500 - 4442526..4443767 (-) 1242 WP_174715308.1 phage portal protein -
  DMB88_RS30300 - 4443773..4443946 (-) 174 WP_164848743.1 hypothetical protein -
  DMB88_RS20245 - 4443943..4445703 (-) 1761 WP_128102795.1 terminase large subunit -
  DMB88_RS20250 - 4445696..4446316 (-) 621 WP_128102796.1 terminase -
  DMB88_RS20255 - 4446361..4446771 (-) 411 WP_128102797.1 hypothetical protein -
  DMB88_RS20260 - 4446758..4447120 (-) 363 WP_128102798.1 HNH endonuclease -
  DMB88_RS20265 - 4447124..4447612 (-) 489 WP_128102799.1 hypothetical protein -
  DMB88_RS20270 - 4447760..4448071 (-) 312 WP_128102800.1 hypothetical protein -
  DMB88_RS20275 - 4449086..4449421 (-) 336 WP_128102801.1 hypothetical protein -
  DMB88_RS20280 - 4449375..4449725 (-) 351 WP_128102802.1 hypothetical protein -
  DMB88_RS20285 - 4450060..4450356 (-) 297 WP_128102803.1 hypothetical protein -
  DMB88_RS20290 - 4450353..4450769 (-) 417 WP_128102804.1 hypothetical protein -
  DMB88_RS20295 - 4450759..4451145 (-) 387 WP_254438272.1 hypothetical protein -
  DMB88_RS20300 - 4451157..4451390 (-) 234 WP_254438273.1 hypothetical protein -
  DMB88_RS20305 - 4451744..4452001 (-) 258 WP_128102805.1 hypothetical protein -
  DMB88_RS20310 - 4452047..4453012 (-) 966 WP_128102806.1 DUF3102 domain-containing protein -
  DMB88_RS32170 - 4453116..4453295 (-) 180 WP_164848744.1 PcfJ domain-containing protein -
  DMB88_RS20320 - 4453259..4454581 (-) 1323 WP_128102807.1 PcfJ domain-containing protein -
  DMB88_RS20325 - 4454553..4454909 (-) 357 WP_128102808.1 hypothetical protein -
  DMB88_RS20330 - 4454912..4455514 (-) 603 WP_128102809.1 hypothetical protein -
  DMB88_RS20335 - 4455511..4455942 (-) 432 WP_128102810.1 hypothetical protein -
  DMB88_RS20340 - 4456173..4456538 (-) 366 WP_128102811.1 hypothetical protein -
  DMB88_RS20345 - 4456773..4457156 (-) 384 WP_128102812.1 hypothetical protein -
  DMB88_RS20350 - 4457149..4457598 (-) 450 WP_254438274.1 hypothetical protein -
  DMB88_RS20355 - 4457695..4458003 (-) 309 WP_128102813.1 hypothetical protein -
  DMB88_RS32175 - 4458172..4458396 (+) 225 WP_128102814.1 helix-turn-helix transcriptional regulator -
  DMB88_RS20365 - 4458510..4458746 (-) 237 WP_128102815.1 hypothetical protein -
  DMB88_RS20370 - 4458810..4459127 (-) 318 WP_254438275.1 AlpA family transcriptional regulator -
  DMB88_RS20375 - 4459164..4459370 (-) 207 WP_128102816.1 helix-turn-helix domain-containing protein -
  DMB88_RS20380 - 4459564..4459989 (+) 426 WP_164848745.1 helix-turn-helix transcriptional regulator -
  DMB88_RS20385 - 4459999..4460409 (+) 411 WP_128102818.1 ImmA/IrrE family metallo-endopeptidase -
  DMB88_RS20390 - 4460484..4461764 (+) 1281 WP_128102819.1 site-specific integrase -
  DMB88_RS20400 - 4462208..4462663 (-) 456 WP_128102820.1 general stress protein -
  DMB88_RS20405 - 4462885..4463106 (+) 222 WP_128102821.1 hypothetical protein -

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 15919.78 Da        Isoelectric Point: 4.6455

>NTDB_id=294426 DMB88_RS20110 WP_254438660.1 4424635..4425069(-) (nucA/comI) [Paenibacillus sp. DCT19 isolate rhisosphere]
MYRLVKYIIGLFIAAAAAFGLYNVEPHTEVTQIQQQAPDITITFPADRYPETALHIKEAVAAGHSDTCTIDREGADNNRD
LSLRGVDTKKGYDRDEWPMAMCAEGGEGADIKYISPKDNRGAGSWVGHQLSDYPDGTRVQFIIE

Nucleotide


Download         Length: 435 bp        

>NTDB_id=294426 DMB88_RS20110 WP_254438660.1 4424635..4425069(-) (nucA/comI) [Paenibacillus sp. DCT19 isolate rhisosphere]
GTGTATAGGTTGGTTAAGTACATAATAGGTTTATTCATTGCGGCAGCGGCAGCTTTCGGTCTTTATAACGTAGAGCCACA
CACAGAGGTAACACAGATTCAGCAGCAAGCACCGGACATTACTATTACGTTTCCCGCTGATCGATACCCAGAGACAGCAC
TACACATTAAAGAGGCTGTAGCAGCCGGACACTCAGACACATGCACAATTGATAGAGAGGGAGCAGACAATAACCGGGAT
CTGTCGTTAAGAGGTGTAGACACCAAGAAGGGTTATGATCGTGATGAATGGCCTATGGCTATGTGCGCCGAGGGTGGAGA
GGGCGCAGACATCAAATACATAAGTCCAAAAGATAATCGCGGTGCTGGTAGCTGGGTGGGTCACCAACTCAGTGATTATC
CAGATGGCACCAGGGTACAATTTATAATTGAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(48-140)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

67.568

77.083

0.521

Multiple sequence alignment