Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQY74_RS14700 Genome accession   NZ_CP035228
Coordinates   2766019..2766195 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   Q65HF5
Organism   Bacillus licheniformis strain SRCM103529     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2761019..2771195
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQY74_RS14685 (EQY74_14685) gcvT 2761660..2762754 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  EQY74_RS14690 (EQY74_14690) - 2763348..2765027 (+) 1680 WP_003183439.1 SNF2-related protein -
  EQY74_RS14695 (EQY74_14695) - 2765034..2765828 (+) 795 WP_128739468.1 YqhG family protein -
  EQY74_RS14700 (EQY74_14700) sinI 2766019..2766195 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  EQY74_RS14705 (EQY74_14705) sinR 2766229..2766564 (+) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  EQY74_RS14710 (EQY74_14710) - 2766669..2767463 (-) 795 WP_003183447.1 TasA family protein -
  EQY74_RS14715 (EQY74_14715) - 2767537..2768121 (-) 585 WP_003183449.1 signal peptidase I -
  EQY74_RS14720 (EQY74_14720) tapA 2768118..2768846 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  EQY74_RS14725 (EQY74_14725) - 2769156..2769443 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  EQY74_RS14730 (EQY74_14730) - 2769473..2769655 (-) 183 WP_003183456.1 YqzE family protein -
  EQY74_RS14735 (EQY74_14735) comGG 2769744..2770109 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  EQY74_RS14740 (EQY74_14740) comGF 2770122..2770610 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  EQY74_RS14745 (EQY74_14745) comGE 2770519..2770866 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=294399 EQY74_RS14700 WP_003183444.1 2766019..2766195(+) (sinI) [Bacillus licheniformis strain SRCM103529]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=294399 EQY74_RS14700 WP_003183444.1 2766019..2766195(+) (sinI) [Bacillus licheniformis strain SRCM103529]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q65HF5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517