Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   EQJ84_RS12235 Genome accession   NZ_CP035191
Coordinates   2395389..2395772 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM104011     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2390389..2400772
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ84_RS12195 (EQJ84_12195) sinI 2391322..2391495 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  EQJ84_RS12200 (EQJ84_12200) sinR 2391529..2391864 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQJ84_RS12205 (EQJ84_12205) tasA 2391956..2392741 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  EQJ84_RS12210 (EQJ84_12210) sipW 2392806..2393378 (-) 573 WP_077671469.1 signal peptidase I SipW -
  EQJ84_RS12215 (EQJ84_12215) tapA 2393362..2394123 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  EQJ84_RS12220 (EQJ84_12220) yqzG 2394395..2394721 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQJ84_RS12225 (EQJ84_12225) spoIITA 2394763..2394942 (-) 180 WP_014480252.1 YqzE family protein -
  EQJ84_RS12230 (EQJ84_12230) comGG 2395014..2395388 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  EQJ84_RS12235 (EQJ84_12235) comGF 2395389..2395772 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  EQJ84_RS12240 (EQJ84_12240) comGE 2395798..2396145 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  EQJ84_RS12245 (EQJ84_12245) comGD 2396129..2396560 (-) 432 WP_038829732.1 comG operon protein ComGD Machinery gene
  EQJ84_RS12250 (EQJ84_12250) comGC 2396550..2396846 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  EQJ84_RS12255 (EQJ84_12255) comGB 2396860..2397897 (-) 1038 WP_077671432.1 comG operon protein ComGB Machinery gene
  EQJ84_RS12260 (EQJ84_12260) comGA 2397884..2398954 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  EQJ84_RS12265 (EQJ84_12265) - 2399182..2399364 (-) 183 WP_033884706.1 hypothetical protein -
  EQJ84_RS12270 (EQJ84_12270) corA 2399366..2400319 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=294097 EQJ84_RS12235 WP_032726158.1 2395389..2395772(-) (comGF) [Bacillus subtilis strain SRCM104011]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=294097 EQJ84_RS12235 WP_032726158.1 2395389..2395772(-) (comGF) [Bacillus subtilis strain SRCM104011]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment