Detailed information    

insolico Bioinformatically predicted

Overview


Name   rcrR   Type   Regulator
Locus tag   DK182_RS05095 Genome accession   NZ_CP029491
Coordinates   1027773..1028201 (+) Length   142 a.a.
NCBI ID   WP_002959424.1    Uniprot ID   U2J2W6
Organism   Streptococcus sobrinus strain 10919     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1008799..1034429 1027773..1028201 within 0


Gene organization within MGE regions


Location: 1008799..1034429
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DK182_RS05015 (DK181_05015) - 1008799..1010004 (+) 1206 WP_019777321.1 CCA tRNA nucleotidyltransferase -
  DK182_RS05020 (DK181_05020) - 1010106..1011992 (+) 1887 WP_019777320.1 ABC-F family ATP-binding cassette domain-containing protein -
  DK182_RS05025 (DK181_05025) - 1012056..1012469 (+) 414 WP_019777319.1 hypothetical protein -
  DK182_RS05035 (DK181_05035) - 1012779..1014515 (+) 1737 WP_019777318.1 ABC transporter ATP-binding protein -
  DK182_RS05040 (DK181_05040) - 1014765..1016516 (+) 1752 WP_109833551.1 ABC transporter ATP-binding protein -
  DK182_RS05045 (DK181_05045) - 1016684..1017448 (-) 765 WP_002963402.1 NUDIX domain-containing protein -
  DK182_RS05050 (DK181_05050) pnuC 1017445..1018266 (-) 822 WP_019777315.1 nicotinamide riboside transporter PnuC -
  DK182_RS05055 (DK181_05055) - 1018282..1019388 (-) 1107 WP_109833552.1 AAA family ATPase -
  DK182_RS05060 (DK181_05060) - 1020087..1020596 (-) 510 WP_002963409.1 HdeD family acid-resistance protein -
  DK182_RS05065 (DK181_05065) gdhA 1020819..1022171 (+) 1353 WP_002963410.1 NADP-specific glutamate dehydrogenase -
  DK182_RS05070 (DK181_05070) - 1022760..1023212 (+) 453 WP_002959432.1 LytTR family DNA-binding domain-containing protein -
  DK182_RS05075 (DK181_05075) - 1023202..1023642 (+) 441 WP_019774954.1 DUF3021 family protein -
  DK182_RS05080 (DK181_05080) - 1023644..1024489 (+) 846 WP_019780942.1 ABC transporter ATP-binding protein -
  DK182_RS05085 (DK181_05085) - 1024470..1025258 (+) 789 WP_109833553.1 ABC transporter permease subunit -
  DK182_RS05090 (DK181_05090) - 1025455..1027551 (-) 2097 WP_109833554.1 surface-anchored 5'-nucleotidase -
  DK182_RS05095 (DK181_05095) rcrR 1027773..1028201 (+) 429 WP_002959424.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  DK182_RS05100 (DK181_05100) rcrP 1028209..1030038 (+) 1830 WP_019769131.1 ABC transporter ATP-binding protein Regulator
  DK182_RS05105 (DK181_05105) rcrQ 1030028..1031776 (+) 1749 WP_019777523.1 ABC transporter ATP-binding protein Regulator
  DK182_RS05110 (DK181_05110) - 1032134..1032769 (+) 636 WP_002959419.1 ABC transporter permease -
  DK182_RS05115 (DK181_05115) - 1032759..1033673 (+) 915 WP_019774949.1 glycine betaine ABC transporter substrate-binding protein -
  DK182_RS05120 (DK181_05120) - 1033680..1034429 (+) 750 WP_019774948.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 142 a.a.        Molecular weight: 16696.60 Da        Isoelectric Point: 10.3649

>NTDB_id=293212 DK182_RS05095 WP_002959424.1 1027773..1028201(+) (rcrR) [Streptococcus sobrinus strain 10919]
MKDPFDIFRTFINTMETSVQELAKKHGVEHLAGPQGFTVSYLFENRDKEIFIKDIEERLRISKSVASNLIKRMEKNGFIQ
VKPSLKDKRYKQIVLTELGLDKAEKIKVFRSKIEEIILKDIDKKNLEVARRVFLQIKTNLEK

Nucleotide


Download         Length: 429 bp        

>NTDB_id=293212 DK182_RS05095 WP_002959424.1 1027773..1028201(+) (rcrR) [Streptococcus sobrinus strain 10919]
ATGAAAGATCCCTTTGACATTTTCAGAACTTTCATCAATACTATGGAAACTAGTGTCCAAGAGTTGGCCAAAAAGCATGG
GGTGGAGCATTTAGCTGGCCCCCAAGGCTTTACGGTCTCTTATCTTTTTGAAAACCGAGACAAAGAAATTTTCATAAAAG
ACATTGAAGAGAGGCTAAGAATTTCCAAATCTGTCGCTAGTAATCTCATCAAACGGATGGAGAAGAATGGCTTTATCCAA
GTCAAGCCTTCCCTCAAGGACAAACGCTATAAGCAGATTGTTCTGACAGAACTTGGCCTTGATAAGGCTGAGAAGATTAA
GGTATTCCGTTCCAAAATCGAAGAGATTATTCTTAAGGATATTGATAAGAAGAATCTGGAAGTTGCCCGCCGGGTTTTTT
TGCAAATCAAAACTAATTTAGAAAAGTAG

Domains


Predicted by InterproScan.

(46-89)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB U2J2W6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

64.789

100

0.648


Multiple sequence alignment