Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   B7L90_RS14040 Genome accession   NZ_CP029473
Coordinates   2813846..2813986 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Hx05     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2808846..2818986
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B7L90_RS14015 (B7L90_14145) - 2809152..2809550 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  B7L90_RS14020 (B7L90_14140) - 2809647..2810198 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  B7L90_RS14025 (B7L90_14135) - 2810216..2811682 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  B7L90_RS14030 (B7L90_14130) - 2811812..2813032 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  B7L90_RS14035 (B7L90_14125) - 2813039..2813380 (-) 342 WP_014305721.1 hypothetical protein -
  B7L90_RS14040 (B7L90_14120) degQ 2813846..2813986 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  B7L90_RS14045 (B7L90_14115) - 2814194..2815054 (+) 861 WP_159073777.1 polyprenyl synthetase family protein -
  B7L90_RS14050 (B7L90_14110) comX 2815023..2815196 (+) 174 WP_012118314.1 competence pheromone ComX -
  B7L90_RS14055 (B7L90_14105) - 2815210..2817509 (+) 2300 Protein_2693 histidine kinase -
  B7L90_RS14060 (B7L90_14100) comA 2817590..2818234 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  B7L90_RS14065 (B7L90_14095) - 2818256..2818639 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=292948 B7L90_RS14040 WP_003152043.1 2813846..2813986(+) (degQ) [Bacillus velezensis strain Hx05]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=292948 B7L90_RS14040 WP_003152043.1 2813846..2813986(+) (degQ) [Bacillus velezensis strain Hx05]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment