Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   B7L90_RS07485 Genome accession   NZ_CP029473
Coordinates   1545849..1545968 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Hx05     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1540849..1550968
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B7L90_RS07455 (B7L90_01000) - 1541088..1541846 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  B7L90_RS07460 (B7L90_00995) - 1541840..1542787 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  B7L90_RS07465 (B7L90_00990) ceuB 1542777..1543730 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  B7L90_RS07475 (B7L90_00980) - 1544145..1545509 (+) 1365 WP_003156333.1 aspartate kinase -
  B7L90_RS07480 (B7L90_00975) - 1545604..1545699 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  B7L90_RS07485 (B7L90_00970) phrC 1545849..1545968 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  B7L90_RS07490 (B7L90_00965) rapC 1545952..1547100 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  B7L90_RS07495 (B7L90_00960) - 1547253..1548686 (-) 1434 WP_162130794.1 HAMP domain-containing sensor histidine kinase -
  B7L90_RS07500 (B7L90_00955) - 1548673..1549356 (-) 684 WP_103695313.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=292925 B7L90_RS07485 WP_003156334.1 1545849..1545968(-) (phrC) [Bacillus velezensis strain Hx05]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=292925 B7L90_RS07485 WP_003156334.1 1545849..1545968(-) (phrC) [Bacillus velezensis strain Hx05]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment