Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQH88_RS12730 Genome accession   NZ_CP035161
Coordinates   2452574..2452747 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103862     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2447574..2457747
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH88_RS12715 (EQH88_12715) gcvT 2448374..2449462 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  EQH88_RS12720 (EQH88_12720) hepAA 2449903..2451576 (+) 1674 WP_029726726.1 SNF2-related protein -
  EQH88_RS12725 (EQH88_12725) yqhG 2451597..2452391 (+) 795 WP_015714249.1 YqhG family protein -
  EQH88_RS12730 (EQH88_12730) sinI 2452574..2452747 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQH88_RS12735 (EQH88_12735) sinR 2452781..2453116 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQH88_RS12740 (EQH88_12740) tasA 2453209..2453994 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQH88_RS12745 (EQH88_12745) sipW 2454058..2454630 (-) 573 WP_072692741.1 signal peptidase I SipW -
  EQH88_RS12750 (EQH88_12750) tapA 2454614..2455375 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  EQH88_RS12755 (EQH88_12755) yqzG 2455646..2455972 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQH88_RS12760 (EQH88_12760) spoIITA 2456014..2456193 (-) 180 WP_029726723.1 YqzE family protein -
  EQH88_RS12765 (EQH88_12765) comGG 2456265..2456639 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  EQH88_RS12770 (EQH88_12770) comGF 2456640..2457023 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  EQH88_RS12775 (EQH88_12775) comGE 2457049..2457396 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=292572 EQH88_RS12730 WP_003230187.1 2452574..2452747(+) (sinI) [Bacillus subtilis strain SRCM103862]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=292572 EQH88_RS12730 WP_003230187.1 2452574..2452747(+) (sinI) [Bacillus subtilis strain SRCM103862]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment