Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | FORC087_RS12720 | Genome accession | NZ_CP029454 |
| Coordinates | 2463448..2463726 (+) | Length | 92 a.a. |
| NCBI ID | WP_139894488.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain FORC087 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2453402..2497384 | 2463448..2463726 | within | 0 |
Gene organization within MGE regions
Location: 2453402..2497384
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC087_RS12645 (FORC087_2494) | - | 2453402..2453665 (+) | 264 | WP_002101034.1 | DUF3937 family protein | - |
| FORC087_RS12650 (FORC087_2495) | - | 2454222..2454542 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| FORC087_RS12655 | - | 2454688..2454822 (+) | 135 | Protein_2410 | site-specific integrase | - |
| FORC087_RS12660 (FORC087_2496) | - | 2455032..2455517 (+) | 486 | WP_098290865.1 | homoserine dehydrogenase | - |
| FORC087_RS12665 (FORC087_2497) | - | 2455827..2456498 (+) | 672 | WP_061139255.1 | DUF3962 domain-containing protein | - |
| FORC087_RS12670 (FORC087_2498) | - | 2456567..2457676 (-) | 1110 | WP_061139254.1 | tyrosine-type recombinase/integrase | - |
| FORC087_RS12675 (FORC087_2500) | - | 2458323..2459531 (+) | 1209 | WP_139894484.1 | AimR family lysis-lysogeny pheromone receptor | - |
| FORC087_RS12680 (FORC087_2501) | - | 2459558..2459713 (+) | 156 | WP_000791664.1 | hypothetical protein | - |
| FORC087_RS12685 (FORC087_2503) | - | 2459974..2460324 (-) | 351 | WP_000425256.1 | helix-turn-helix transcriptional regulator | - |
| FORC087_RS12690 (FORC087_2504) | - | 2460508..2460804 (+) | 297 | WP_061139252.1 | helix-turn-helix transcriptional regulator | - |
| FORC087_RS31400 | - | 2460860..2460961 (+) | 102 | Protein_2418 | ORF6C domain-containing protein | - |
| FORC087_RS12700 (FORC087_2505) | - | 2461020..2461286 (+) | 267 | WP_000522024.1 | helix-turn-helix domain-containing protein | - |
| FORC087_RS30910 (FORC087_2506) | - | 2461286..2461450 (+) | 165 | WP_000390298.1 | hypothetical protein | - |
| FORC087_RS30915 (FORC087_2507) | - | 2461480..2461656 (+) | 177 | WP_180985139.1 | hypothetical protein | - |
| FORC087_RS12705 (FORC087_2508) | - | 2461661..2462407 (+) | 747 | WP_139894485.1 | DnaD domain protein | - |
| FORC087_RS12710 (FORC087_2509) | - | 2462346..2463221 (+) | 876 | WP_139894486.1 | ATP-binding protein | - |
| FORC087_RS12715 (FORC087_2510) | - | 2463237..2463431 (+) | 195 | WP_139894487.1 | hypothetical protein | - |
| FORC087_RS12720 (FORC087_2511) | abrB | 2463448..2463726 (+) | 279 | WP_139894488.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| FORC087_RS12725 (FORC087_2512) | - | 2463719..2464078 (+) | 360 | WP_139894489.1 | cell division protein SepF | - |
| FORC087_RS12730 (FORC087_2513) | - | 2464097..2464264 (+) | 168 | WP_089171096.1 | DUF3954 domain-containing protein | - |
| FORC087_RS12735 (FORC087_2514) | - | 2464290..2464541 (+) | 252 | WP_139894490.1 | helix-turn-helix domain containing protein | - |
| FORC087_RS12740 (FORC087_2515) | - | 2464561..2465016 (+) | 456 | WP_139894491.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| FORC087_RS31755 (FORC087_2516) | - | 2465230..2465955 (-) | 726 | WP_139894492.1 | exosporium leader peptide-containing protein | - |
| FORC087_RS12750 (FORC087_2517) | - | 2466137..2466496 (-) | 360 | WP_139894493.1 | septum formation initiator family protein | - |
| FORC087_RS12755 (FORC087_2519) | - | 2467018..2467212 (-) | 195 | WP_065212698.1 | hypothetical protein | - |
| FORC087_RS12760 (FORC087_2521) | - | 2467741..2467986 (+) | 246 | WP_139894494.1 | DUF3947 family protein | - |
| FORC087_RS12765 (FORC087_2523) | - | 2469248..2469463 (-) | 216 | WP_139894495.1 | spore germination protein | - |
| FORC087_RS12770 (FORC087_2524) | - | 2469695..2469892 (+) | 198 | WP_139894496.1 | hypothetical protein | - |
| FORC087_RS30920 (FORC087_2525) | - | 2470009..2470179 (+) | 171 | WP_180985140.1 | hypothetical protein | - |
| FORC087_RS12775 (FORC087_2526) | - | 2470207..2470671 (+) | 465 | WP_139894497.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FORC087_RS12780 (FORC087_2527) | - | 2470689..2471220 (+) | 532 | Protein_2438 | tyrosine-type recombinase/integrase | - |
| FORC087_RS12785 (FORC087_2528) | - | 2471703..2473241 (+) | 1539 | WP_139894498.1 | S53 family peptidase | - |
| FORC087_RS12790 | - | 2473301..2473390 (+) | 90 | WP_255289252.1 | DUF3983 domain-containing protein | - |
| FORC087_RS30925 (FORC087_2530) | - | 2473504..2473674 (+) | 171 | WP_098522157.1 | hypothetical protein | - |
| FORC087_RS12795 (FORC087_2531) | - | 2473698..2474171 (+) | 474 | WP_098522156.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FORC087_RS12800 (FORC087_2532) | - | 2474168..2474710 (+) | 543 | WP_098522155.1 | tyrosine-type recombinase/integrase | - |
| FORC087_RS12805 (FORC087_2533) | - | 2475052..2475900 (-) | 849 | WP_098522154.1 | DUF346 domain-containing protein | - |
| FORC087_RS12815 (FORC087_2534) | - | 2476444..2476827 (+) | 384 | WP_139894500.1 | hypothetical protein | - |
| FORC087_RS12820 (FORC087_2535) | - | 2476828..2477040 (+) | 213 | WP_048567684.1 | hypothetical protein | - |
| FORC087_RS12825 (FORC087_2536) | - | 2477177..2477431 (+) | 255 | WP_048567683.1 | hypothetical protein | - |
| FORC087_RS12830 | - | 2477421..2477798 (+) | 378 | WP_086403181.1 | HNH endonuclease | - |
| FORC087_RS12835 (FORC087_2538) | - | 2477928..2478431 (+) | 504 | WP_086691942.1 | phage terminase small subunit P27 family | - |
| FORC087_RS12840 (FORC087_2539) | - | 2478433..2480127 (+) | 1695 | WP_139894501.1 | terminase TerL endonuclease subunit | - |
| FORC087_RS12845 (FORC087_2541) | - | 2480316..2481569 (+) | 1254 | WP_139894502.1 | phage portal protein | - |
| FORC087_RS12850 (FORC087_2542) | - | 2481556..2482266 (+) | 711 | WP_139894503.1 | head maturation protease, ClpP-related | - |
| FORC087_RS12855 (FORC087_2543) | - | 2482304..2483476 (+) | 1173 | WP_139894504.1 | phage major capsid protein | - |
| FORC087_RS12860 (FORC087_2544) | - | 2483497..2483793 (+) | 297 | WP_139894505.1 | head-tail connector protein | - |
| FORC087_RS12865 (FORC087_2545) | - | 2483771..2484094 (+) | 324 | WP_139894506.1 | phage head closure protein | - |
| FORC087_RS12870 (FORC087_2546) | - | 2484087..2484521 (+) | 435 | WP_139894507.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FORC087_RS12875 (FORC087_2547) | - | 2484518..2484877 (+) | 360 | WP_098522148.1 | DUF3168 domain-containing protein | - |
| FORC087_RS12880 (FORC087_2548) | - | 2484878..2485483 (+) | 606 | WP_097820525.1 | major tail protein | - |
| FORC087_RS12885 (FORC087_2549) | - | 2485532..2485849 (+) | 318 | WP_075717239.1 | hypothetical protein | - |
| FORC087_RS30930 (FORC087_2550) | - | 2485879..2486055 (+) | 177 | WP_153588223.1 | hypothetical protein | - |
| FORC087_RS12890 | - | 2486071..2487351 (+) | 1281 | Protein_2461 | phage tail tape measure protein | - |
| FORC087_RS12895 | - | 2487568..2490186 (+) | 2619 | WP_139894509.1 | phage tail tape measure protein | - |
| FORC087_RS12900 (FORC087_2552) | - | 2490201..2491682 (+) | 1482 | WP_098770087.1 | distal tail protein Dit | - |
| FORC087_RS12905 (FORC087_2553) | - | 2491679..2495710 (+) | 4032 | WP_139894510.1 | phage tail spike protein | - |
| FORC087_RS12910 (FORC087_2554) | - | 2495838..2496062 (+) | 225 | WP_000390479.1 | hypothetical protein | - |
| FORC087_RS12915 (FORC087_2555) | - | 2496138..2496563 (+) | 426 | WP_139894511.1 | phage holin family protein | - |
| FORC087_RS12920 (FORC087_2556) | - | 2496563..2497384 (+) | 822 | WP_139894512.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10036.58 Da Isoelectric Point: 6.2261
>NTDB_id=292490 FORC087_RS12720 WP_139894488.1 2463448..2463726(+) (abrB) [Bacillus cereus strain FORC087]
MKNTGVSRKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENVVLRKHEKSCFVTGTVSESNIELLDGRMFLSKEGATEL
LDILEKSGMVHG
MKNTGVSRKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENVVLRKHEKSCFVTGTVSESNIELLDGRMFLSKEGATEL
LDILEKSGMVHG
Nucleotide
Download Length: 279 bp
>NTDB_id=292490 FORC087_RS12720 WP_139894488.1 2463448..2463726(+) (abrB) [Bacillus cereus strain FORC087]
ATGAAAAACACTGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGAGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTTCATGTTGAAGGGGAAAACGTTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACTGGCACAGTTTCTGAATCAAACATTGAATTGTTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGGAATGGTACATGGCTAA
ATGAAAAACACTGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGAGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTTCATGTTGAAGGGGAAAACGTTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACTGGCACAGTTTCTGAATCAAACATTGAATTGTTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGGAATGGTACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.627 |
90.217 |
0.511 |