Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   DEH83_RS07205 Genome accession   NZ_CP029207
Coordinates   1404232..1404525 (+) Length   97 a.a.
NCBI ID   WP_150890982.1    Uniprot ID   -
Organism   Streptococcus constellatus strain TCV107     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1393257..1408184 1404232..1404525 within 0


Gene organization within MGE regions


Location: 1393257..1408184
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DEH83_RS07110 (DEH83_07120) - 1393257..1393532 (+) 276 WP_003036014.1 HU family DNA-binding protein -
  DEH83_RS07115 (DEH83_07125) - 1393701..1394162 (+) 462 WP_003035860.1 Fur family transcriptional regulator -
  DEH83_RS07120 (DEH83_07130) - 1394300..1394992 (+) 693 WP_003036126.1 phosphoglycerate mutase -
  DEH83_RS07125 (DEH83_07135) - 1395150..1396313 (-) 1164 WP_255776475.1 site-specific integrase -
  DEH83_RS07130 (DEH83_07140) - 1396381..1397235 (-) 855 WP_255776476.1 helix-turn-helix domain-containing protein -
  DEH83_RS07135 (DEH83_07145) - 1397377..1397583 (+) 207 WP_255776477.1 helix-turn-helix transcriptional regulator -
  DEH83_RS07140 (DEH83_07150) - 1397795..1397989 (+) 195 WP_255776478.1 hypothetical protein -
  DEH83_RS07145 (DEH83_07155) - 1398000..1398266 (+) 267 WP_006268135.1 HTH domain-containing protein -
  DEH83_RS07150 (DEH83_07160) - 1398278..1398472 (+) 195 WP_006268001.1 hypothetical protein -
  DEH83_RS07155 (DEH83_07165) - 1398465..1399280 (+) 816 WP_255776479.1 DnaD domain protein -
  DEH83_RS07160 (DEH83_07170) - 1399296..1400123 (+) 828 WP_255776480.1 ATP-binding protein -
  DEH83_RS07165 (DEH83_07175) - 1400424..1400915 (+) 492 WP_255776481.1 hypothetical protein -
  DEH83_RS07170 - 1401235..1401411 (+) 177 WP_006267997.1 hypothetical protein -
  DEH83_RS07175 (DEH83_07180) - 1401491..1402123 (+) 633 WP_255776482.1 hypothetical protein -
  DEH83_RS07180 (DEH83_07185) - 1402124..1402603 (+) 480 WP_255776483.1 hypothetical protein -
  DEH83_RS07185 (DEH83_07190) - 1402584..1402994 (+) 411 WP_255776484.1 hypothetical protein -
  DEH83_RS07190 (DEH83_07195) - 1403277..1403456 (+) 180 WP_255776485.1 hypothetical protein -
  DEH83_RS07195 (DEH83_07200) - 1403536..1403811 (+) 276 WP_255776486.1 terminase small subunit -
  DEH83_RS07200 (DEH83_07205) - 1403877..1404242 (+) 366 WP_006268450.1 type II toxin-antitoxin system RelE/ParE family toxin -
  DEH83_RS07205 (DEH83_07210) HI0659 1404232..1404525 (+) 294 WP_150890982.1 helix-turn-helix domain-containing protein Machinery gene
  DEH83_RS07210 (DEH83_07215) - 1404617..1405162 (+) 546 WP_255776487.1 hypothetical protein -
  DEH83_RS07215 (DEH83_07220) pbp2b 1405511..1407577 (+) 2067 WP_255776488.1 penicillin-binding protein PBP2B -
  DEH83_RS07220 (DEH83_07225) recR 1407588..1408184 (+) 597 WP_039677306.1 recombination mediator RecR -

Sequence

Protein


Download         Length: 97 a.a.        Molecular weight: 10811.48 Da        Isoelectric Point: 4.9123

>NTDB_id=291208 DEH83_RS07205 WP_150890982.1 1404232..1404525(+) (HI0659) [Streptococcus constellatus strain TCV107]
MKNSAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNERGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLDKTLAVVPLEREQV

Nucleotide


Download         Length: 294 bp        

>NTDB_id=291208 DEH83_RS07205 WP_150890982.1 1404232..1404525(+) (HI0659) [Streptococcus constellatus strain TCV107]
ATGAAAAATAGTGCAATTGGTAGTAACTGGAAAGATGTAAGAGCTGAGTTATTCAGCAAAGAAGAAATTTTAGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGGAATGAAAGGGGCATTAGTCAAAAAAAACTAGAGGAACTGA
GTGGCGTTAGTCAGCCAGTCATAGCTAGAATGGAGACAGGAAAAACAAGCCCACAGCTTGATACAGTATTAAAGGTTTTG
GCAAGTCTTGATAAGACTTTAGCAGTTGTACCACTAGAGCGTGAACAAGTCTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

58.242

93.814

0.546

Multiple sequence alignment