Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BAALB65_RS02335 Genome accession   NZ_CP029069
Coordinates   439900..440019 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain ALB65     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 434900..445019
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAALB65_RS02320 (BAALB65_02320) - 436512..437195 (+) 684 WP_109566694.1 response regulator transcription factor -
  BAALB65_RS02325 (BAALB65_02325) - 437182..438609 (+) 1428 WP_089072406.1 HAMP domain-containing sensor histidine kinase -
  BAALB65_RS02330 (BAALB65_02330) rapC 438768..439916 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BAALB65_RS02335 (BAALB65_02335) phrC 439900..440019 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BAALB65_RS02340 (BAALB65_02340) - 440171..440266 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  BAALB65_RS02345 (BAALB65_02345) - 440361..441725 (-) 1365 WP_021495117.1 aspartate kinase -
  BAALB65_RS02350 (BAALB65_02350) ceuB 442139..443092 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  BAALB65_RS02355 (BAALB65_02355) - 443082..444029 (+) 948 WP_109566695.1 iron chelate uptake ABC transporter family permease subunit -
  BAALB65_RS02360 (BAALB65_02360) - 444023..444781 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=289854 BAALB65_RS02335 WP_003156334.1 439900..440019(+) (phrC) [Bacillus amyloliquefaciens strain ALB65]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=289854 BAALB65_RS02335 WP_003156334.1 439900..440019(+) (phrC) [Bacillus amyloliquefaciens strain ALB65]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment