Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilE   Type   Machinery gene
Locus tag   EGH20_RS12515 Genome accession   NZ_CP034026
Coordinates   2114421..2114564 (-) Length   47 a.a.
NCBI ID   WP_010361012.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain FQ20     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2109421..2119564
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGH20_RS12495 (EGH20_12495) pilA 2110888..2112141 (+) 1254 WP_003687004.1 signal recognition particle-docking protein FtsY Machinery gene
  EGH20_RS12505 (EGH20_12505) - 2112435..2113132 (-) 698 Protein_2130 opacity family porin -
  EGH20_RS14570 - 2113114..2113239 (-) 126 WP_276310601.1 hypothetical protein -
  EGH20_RS12510 (EGH20_12510) - 2113657..2114050 (-) 394 Protein_2132 pilin -
  EGH20_RS12515 (EGH20_12515) pilE 2114421..2114564 (-) 144 WP_010361012.1 hypothetical protein Machinery gene
  EGH20_RS14405 (EGH20_12525) - 2114669..2114776 (-) 108 Protein_2134 pilin -
  EGH20_RS12530 (EGH20_12530) pilE 2114899..2115312 (-) 414 WP_165865034.1 pilin Machinery gene
  EGH20_RS12540 (EGH20_12540) lpxC 2115418..2116341 (-) 924 WP_003687007.1 UDP-3-O-acyl-N-acetylglucosamine deacetylase -
  EGH20_RS12545 (EGH20_12545) - 2116843..2117229 (-) 387 Protein_2137 pilin -
  EGH20_RS12555 (EGH20_12555) - 2117497..2117880 (-) 384 Protein_2138 pilin -
  EGH20_RS12565 (EGH20_12565) pilE 2118148..2118570 (-) 423 WP_165865035.1 pilin Machinery gene
  EGH20_RS12570 (EGH20_12570) - 2118709..2119068 (-) 360 Protein_2140 pilin -
  EGH20_RS12575 (EGH20_12575) pilE 2119146..2119559 (-) 414 WP_017146667.1 pilin Machinery gene

Sequence


Protein


Download         Length: 47 a.a.        Molecular weight: 4919.37 Da        Isoelectric Point: 6.7009

>NTDB_id=287360 EGH20_RS12515 WP_010361012.1 2114421..2114564(-) (pilE) [Neisseria gonorrhoeae strain FQ20]
MTGFNDAAGNDKIDTKHLPSTCRDAASAGCTKHHAPISNAFQENGAF

Nucleotide


Download         Length: 144 bp        

>NTDB_id=287360 EGH20_RS12515 WP_010361012.1 2114421..2114564(-) (pilE) [Neisseria gonorrhoeae strain FQ20]
ATGACGGGATTTAATGATGCCGCCGGCAACGACAAAATCGACACCAAGCACCTGCCGTCAACCTGCCGCGACGCAGCATC
TGCCGGTTGCACGAAACACCACGCGCCGATTTCAAATGCTTTCCAAGAAAACGGAGCTTTTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilE Neisseria gonorrhoeae strain FA1090

66.667

63.83

0.426