Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   AOY82_RS14170 Genome accession   NZ_CP028746
Coordinates   2925847..2926476 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain A29     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2916675..2954213 2925847..2926476 within 0


Gene organization within MGE regions


Location: 2916675..2954213
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AOY82_RS14120 (AOY82_15020) tusE 2916946..2917275 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AOY82_RS14125 (AOY82_15025) yccX 2917272..2917550 (-) 279 WP_000048252.1 acylphosphatase -
  AOY82_RS14130 (AOY82_15030) rlmI 2917645..2918835 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AOY82_RS14135 (AOY82_15035) hspQ 2918893..2919210 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AOY82_RS14140 (AOY82_15040) yccU 2919255..2919668 (-) 414 WP_001301418.1 CoA-binding protein -
  AOY82_RS14145 (AOY82_15045) yccT 2919841..2920503 (+) 663 WP_053275137.1 DUF2057 family protein -
  AOY82_RS14150 (AOY82_15050) mgsA 2920599..2921057 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AOY82_RS14155 (AOY82_15055) helD 2921089..2923143 (-) 2055 WP_001295354.1 DNA helicase IV -
  AOY82_RS14160 (AOY82_15060) yccF 2923266..2923712 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AOY82_RS14165 (AOY82_15065) yccS 2923722..2925884 (+) 2163 WP_000875061.1 YccS family putative transporter -
  AOY82_RS14170 (AOY82_15070) sxy/tfoX 2925847..2926476 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AOY82_RS14175 (AOY82_15075) sulA 2926695..2927204 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AOY82_RS14180 (AOY82_15085) ompA 2927561..2928613 (+) 1053 WP_001307702.1 porin OmpA -
  AOY82_RS14185 (AOY82_15090) matP 2928688..2929140 (-) 453 WP_000877158.1 macrodomain Ter protein MatP -
  AOY82_RS14190 (AOY82_15095) ycbZ 2929326..2931086 (+) 1761 WP_000156516.1 Lon protease family protein -
  AOY82_RS14195 (AOY82_15100) fabA 2931155..2931673 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AOY82_RS14200 (AOY82_15105) rmf 2931743..2931910 (-) 168 WP_000828648.1 ribosome modulation factor -
  AOY82_RS14205 (AOY82_15110) pqiC 2932166..2932729 (-) 564 WP_000759095.1 membrane integrity-associated transporter subunit PqiC -
  AOY82_RS14210 (AOY82_15115) pqiB 2932726..2934366 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AOY82_RS14215 (AOY82_15120) pqiA 2934371..2935624 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AOY82_RS14220 (AOY82_15125) uup 2935754..2937661 (-) 1908 WP_000053091.1 ABC transporter ATP-binding protein -
  AOY82_RS14225 (AOY82_15130) rlmKL 2937673..2939781 (-) 2109 WP_201479643.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  AOY82_RS14230 (AOY82_15135) ycbX 2940025..2941134 (+) 1110 WP_021553510.1 6-N-hydroxylaminopurine resistance protein YcbX -
  AOY82_RS14235 (AOY82_15140) zapC 2941131..2941673 (-) 543 WP_001295353.1 cell division protein ZapC -
  AOY82_RS14240 (AOY82_15145) pyrD 2941847..2942857 (-) 1011 WP_001312721.1 quinone-dependent dihydroorotate dehydrogenase -
  AOY82_RS14245 (AOY82_15150) ycbF 2942968..2943705 (-) 738 WP_160454519.1 fimbrial chaperone -
  AOY82_RS14250 (AOY82_15155) ycbV 2943671..2944186 (-) 516 WP_000919493.1 fimbrial protein -
  AOY82_RS14255 (AOY82_15160) ycbU 2944194..2944736 (-) 543 WP_000730614.1 fimbrial protein -
  AOY82_RS14260 (AOY82_15165) elfG 2944748..2945818 (-) 1071 WP_001165668.1 fimbrial protein -
  AOY82_RS14265 (AOY82_15170) elfC 2945809..2948409 (-) 2601 WP_000286333.1 fimbrial biogenesis usher protein -
  AOY82_RS14270 (AOY82_15175) elfD 2948434..2949135 (-) 702 WP_016242023.1 molecular chaperone -
  AOY82_RS14275 (AOY82_15180) - 2949218..2949490 (-) 273 Protein_2805 fimbrial protein -
  AOY82_RS14280 (AOY82_15185) - 2949547..2950698 (+) 1152 WP_001254932.1 IS30-like element IS30 family transposase -
  AOY82_RS14285 (AOY82_15190) - 2950705..2950983 (-) 279 Protein_2807 hypothetical protein -
  AOY82_RS14290 (AOY82_15200) ssuE 2951339..2951914 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  AOY82_RS14295 (AOY82_15205) ssuA 2951907..2952866 (+) 960 WP_001244342.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  AOY82_RS14300 (AOY82_15210) ssuD 2952863..2954008 (+) 1146 WP_000056006.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=287146 AOY82_RS14170 WP_000839153.1 2925847..2926476(-) (sxy/tfoX) [Escherichia coli strain A29]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=287146 AOY82_RS14170 WP_000839153.1 2925847..2926476(-) (sxy/tfoX) [Escherichia coli strain A29]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment