Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   AOY84_RS08690 Genome accession   NZ_CP028744
Coordinates   1868054..1868683 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain A31     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1866333..1905329 1868054..1868683 within 0


Gene organization within MGE regions


Location: 1866333..1905329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AOY84_RS08685 (AOY84_09260) sulA 1867326..1867835 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AOY84_RS08690 (AOY84_09265) sxy/tfoX 1868054..1868683 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AOY84_RS08695 (AOY84_09270) yccS 1868646..1870808 (-) 2163 WP_000875023.1 YccS family putative transporter -
  AOY84_RS08700 (AOY84_09275) yccF 1870818..1871264 (-) 447 WP_001261235.1 YccF domain-containing protein -
  AOY84_RS08705 (AOY84_09280) helD 1871387..1873441 (+) 2055 WP_137415373.1 DNA helicase IV -
  AOY84_RS08710 (AOY84_09285) mgsA 1873473..1873931 (-) 459 WP_000424181.1 methylglyoxal synthase -
  AOY84_RS08715 (AOY84_09290) yccT 1874027..1874689 (-) 663 WP_000847791.1 DUF2057 family protein -
  AOY84_RS08720 (AOY84_09295) yccU 1874862..1875275 (+) 414 WP_001396445.1 CoA-binding protein -
  AOY84_RS08725 (AOY84_09300) hspQ 1875320..1875637 (-) 318 WP_001295356.1 heat shock protein HspQ -
  AOY84_RS08730 (AOY84_09305) - 1875695..1875967 (-) 273 Protein_1696 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AOY84_RS08735 (AOY84_09310) - 1876129..1876518 (-) 390 WP_001281694.1 Mor transcription activator family protein -
  AOY84_RS08740 (AOY84_09315) - 1876490..1876939 (-) 450 WP_016240621.1 regulatory protein GemA -
  AOY84_RS08745 (AOY84_09320) - 1876932..1877147 (-) 216 WP_000123379.1 hypothetical protein -
  AOY84_RS08750 (AOY84_09325) - 1877137..1877367 (-) 231 WP_016238301.1 hypothetical protein -
  AOY84_RS08755 (AOY84_09330) - 1877364..1878047 (-) 684 WP_000131939.1 DUF2786 domain-containing protein -
  AOY84_RS08760 (AOY84_09335) - 1878044..1878349 (-) 306 WP_000197789.1 hypothetical protein -
  AOY84_RS08765 (AOY84_09340) - 1878359..1878631 (-) 273 WP_000632577.1 hypothetical protein -
  AOY84_RS23435 - 1878628..1878822 (-) 195 WP_000576354.1 hypothetical protein -
  AOY84_RS08770 (AOY84_09350) - 1878920..1879450 (-) 531 WP_021575607.1 host-nuclease inhibitor Gam family protein -
  AOY84_RS08775 (AOY84_09355) - 1879478..1879747 (-) 270 WP_000843446.1 hypothetical protein -
  AOY84_RS08780 (AOY84_09360) - 1879750..1880916 (-) 1167 WP_086260149.1 AAA family ATPase -
  AOY84_RS08785 (AOY84_09365) - 1880927..1882696 (-) 1770 WP_021530191.1 DDE-type integrase/transposase/recombinase -
  AOY84_RS08790 (AOY84_09370) - 1882700..1883611 (-) 912 WP_021526139.1 DUF3102 domain-containing protein -
  AOY84_RS08795 (AOY84_09375) - 1883622..1883930 (-) 309 WP_016238307.1 helix-turn-helix domain-containing protein -
  AOY84_RS08800 (AOY84_09385) - 1884240..1884656 (+) 417 WP_016238309.1 helix-turn-helix domain-containing protein -
  AOY84_RS08805 (AOY84_09390) - 1884779..1885672 (+) 894 WP_016238310.1 hypothetical protein -
  AOY84_RS08810 (AOY84_09395) - 1885632..1886069 (+) 438 WP_016238311.1 hypothetical protein -
  AOY84_RS08815 (AOY84_09400) - 1886122..1886889 (-) 768 WP_016238312.1 DNA adenine methylase -
  AOY84_RS08820 (AOY84_09405) - 1887080..1887295 (-) 216 WP_001069611.1 hypothetical protein -
  AOY84_RS08825 (AOY84_09410) - 1887294..1887698 (+) 405 WP_000972294.1 hypothetical protein -
  AOY84_RS08830 (AOY84_09415) - 1887674..1888402 (-) 729 WP_240755051.1 hypothetical protein -
  AOY84_RS08835 (AOY84_09420) - 1888533..1888883 (+) 351 WP_000793146.1 putative holin -
  AOY84_RS08840 (AOY84_09425) - 1888886..1889626 (+) 741 WP_001104440.1 transglycosylase SLT domain-containing protein -
  AOY84_RS08845 (AOY84_09430) - 1889610..1890260 (+) 651 WP_000264664.1 lipoprotein -
  AOY84_RS08850 (AOY84_09435) - 1890257..1890583 (+) 327 WP_000175097.1 membrane protein -
  AOY84_RS08855 (AOY84_09440) - 1890583..1890894 (+) 312 WP_000227700.1 hypothetical protein -
  AOY84_RS08860 (AOY84_09445) - 1890894..1891439 (+) 546 WP_000124060.1 DUF3486 family protein -
  AOY84_RS08865 (AOY84_09450) - 1891490..1893031 (+) 1542 WP_170996123.1 hypothetical protein -
  AOY84_RS08870 (AOY84_09455) - 1893031..1894527 (+) 1497 WP_240755052.1 DUF935 domain-containing protein -
  AOY84_RS08875 (AOY84_09460) - 1894508..1895329 (+) 822 WP_000117562.1 phage minor head protein -
  AOY84_RS08880 (AOY84_09465) - 1895332..1895790 (+) 459 WP_000135517.1 phage virion morphogenesis protein -
  AOY84_RS08885 (AOY84_09470) - 1896005..1897120 (+) 1116 WP_001273073.1 hypothetical protein -
  AOY84_RS08890 (AOY84_09475) - 1897135..1898090 (+) 956 Protein_1729 hypothetical protein -
  AOY84_RS08895 (AOY84_09480) - 1898100..1898438 (+) 339 WP_000537457.1 DUF2190 family protein -
  AOY84_RS08900 (AOY84_09485) - 1898440..1898886 (+) 447 WP_000271668.1 DUF1320 domain-containing protein -
  AOY84_RS08905 (AOY84_09490) - 1898886..1899350 (+) 465 WP_001101800.1 Gp37 family protein -
  AOY84_RS08910 (AOY84_09495) - 1899350..1899601 (+) 252 WP_000666498.1 hypothetical protein -
  AOY84_RS08915 (AOY84_09500) - 1899591..1901018 (+) 1428 WP_000729860.1 phage tail sheath subtilisin-like domain-containing protein -
  AOY84_RS08920 (AOY84_09505) - 1901015..1901539 (+) 525 WP_162828734.1 phage major tail tube protein -
  AOY84_RS08925 (AOY84_09510) - 1901542..1901823 (+) 282 WP_000110116.1 hypothetical protein -
  AOY84_RS08930 (AOY84_09515) - 1901921..1902256 (+) 336 WP_000084230.1 phage tail assembly protein -
  AOY84_RS08935 (AOY84_09520) - 1902201..1902338 (+) 138 WP_086055096.1 GpE family phage tail protein -
  AOY84_RS08940 (AOY84_09525) - 1902432..1904897 (+) 2466 WP_069903382.1 phage tail tape measure protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=287093 AOY84_RS08690 WP_000839153.1 1868054..1868683(+) (sxy/tfoX) [Escherichia coli strain A31]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=287093 AOY84_RS08690 WP_000839153.1 1868054..1868683(+) (sxy/tfoX) [Escherichia coli strain A31]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment