Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   DA379_RS19235 Genome accession   NZ_CP028441
Coordinates   3841191..3841310 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain 131-4     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3836191..3846310
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA379_RS19220 - 3837803..3838486 (+) 684 WP_003156341.1 response regulator transcription factor -
  DA379_RS19225 - 3838473..3839906 (+) 1434 WP_162130794.1 HAMP domain-containing sensor histidine kinase -
  DA379_RS19230 rapC 3840059..3841207 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  DA379_RS19235 phrC 3841191..3841310 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  DA379_RS19240 - 3841460..3841555 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  DA379_RS19245 - 3841650..3843014 (-) 1365 WP_003156333.1 aspartate kinase -
  DA379_RS19255 ceuB 3843429..3844382 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  DA379_RS19260 - 3844372..3845319 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  DA379_RS19265 - 3845313..3846071 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=285119 DA379_RS19235 WP_003156334.1 3841191..3841310(+) (phrC) [Bacillus velezensis strain 131-4]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=285119 DA379_RS19235 WP_003156334.1 3841191..3841310(+) (phrC) [Bacillus velezensis strain 131-4]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment