Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   DA379_RS09690 Genome accession   NZ_CP028441
Coordinates   2007671..2007937 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain 131-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2002671..2012937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA379_RS09640 sinR 2002836..2003171 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DA379_RS09645 tasA 2003219..2004004 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  DA379_RS09650 sipW 2004068..2004652 (-) 585 WP_003153100.1 signal peptidase I SipW -
  DA379_RS09655 tapA 2004624..2005295 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DA379_RS09660 - 2005554..2005883 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DA379_RS09665 - 2005923..2006102 (-) 180 WP_003153093.1 YqzE family protein -
  DA379_RS09670 comGG 2006159..2006536 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA379_RS09675 comGF 2006537..2007037 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  DA379_RS09680 comGE 2006946..2007260 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DA379_RS09685 comGD 2007244..2007681 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  DA379_RS09690 comGC 2007671..2007937 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DA379_RS09695 comGB 2007984..2009021 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  DA379_RS09700 comGA 2009008..2010078 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  DA379_RS09705 - 2010270..2011220 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  DA379_RS09710 - 2011366..2012667 (+) 1302 WP_003153081.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=285079 DA379_RS09690 WP_042635730.1 2007671..2007937(-) (comGC) [Bacillus velezensis strain 131-4]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=285079 DA379_RS09690 WP_042635730.1 2007671..2007937(-) (comGC) [Bacillus velezensis strain 131-4]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602

Multiple sequence alignment