Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DA378_RS19235 Genome accession   NZ_CP028440
Coordinates   3842726..3842899 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain J7-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3837726..3847899
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA378_RS19185 comGD 3837848..3838285 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  DA378_RS19190 comGE 3838269..3838583 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DA378_RS19885 comGF 3838776..3838991 (+) 216 WP_254051908.1 ComGF family competence protein Machinery gene
  DA378_RS19200 comGG 3838992..3839369 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA378_RS19205 - 3839426..3839605 (+) 180 WP_003153093.1 YqzE family protein -
  DA378_RS19210 - 3839645..3839974 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DA378_RS19215 tapA 3840233..3840904 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DA378_RS19220 sipW 3840876..3841460 (+) 585 WP_003153100.1 signal peptidase I SipW -
  DA378_RS19225 tasA 3841524..3842309 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  DA378_RS19230 sinR 3842357..3842692 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DA378_RS19235 sinI 3842726..3842899 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  DA378_RS19240 - 3843076..3843870 (-) 795 WP_003153106.1 YqhG family protein -
  DA378_RS19245 - 3843888..3845558 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  DA378_RS19250 gcvT 3845981..3847081 (+) 1101 WP_003153108.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=285043 DA378_RS19235 WP_003153105.1 3842726..3842899(-) (sinI) [Bacillus velezensis strain J7-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=285043 DA378_RS19235 WP_003153105.1 3842726..3842899(-) (sinI) [Bacillus velezensis strain J7-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment