Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   DA378_RS19180 Genome accession   NZ_CP028440
Coordinates   3837592..3837858 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain J7-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3832592..3842858
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA378_RS19160 - 3832862..3834163 (-) 1302 WP_003153081.1 hemolysin family protein -
  DA378_RS19165 - 3834309..3835259 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  DA378_RS19170 comGA 3835451..3836521 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  DA378_RS19175 comGB 3836508..3837545 (+) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  DA378_RS19180 comGC 3837592..3837858 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DA378_RS19185 comGD 3837848..3838285 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  DA378_RS19190 comGE 3838269..3838583 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DA378_RS19885 comGF 3838776..3838991 (+) 216 WP_254051908.1 ComGF family competence protein Machinery gene
  DA378_RS19200 comGG 3838992..3839369 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA378_RS19205 - 3839426..3839605 (+) 180 WP_003153093.1 YqzE family protein -
  DA378_RS19210 - 3839645..3839974 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DA378_RS19215 tapA 3840233..3840904 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DA378_RS19220 sipW 3840876..3841460 (+) 585 WP_003153100.1 signal peptidase I SipW -
  DA378_RS19225 tasA 3841524..3842309 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  DA378_RS19230 sinR 3842357..3842692 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=285039 DA378_RS19180 WP_042635730.1 3837592..3837858(+) (comGC) [Bacillus velezensis strain J7-1]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=285039 DA378_RS19180 WP_042635730.1 3837592..3837858(+) (comGC) [Bacillus velezensis strain J7-1]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment