Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   DA378_RS09630 Genome accession   NZ_CP028440
Coordinates   2004218..2004337 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain J7-1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 1999218..2009337
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA378_RS09600 - 1999457..2000215 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  DA378_RS09605 - 2000209..2001156 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  DA378_RS09610 ceuB 2001146..2002099 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  DA378_RS09620 - 2002514..2003878 (+) 1365 WP_003156333.1 aspartate kinase -
  DA378_RS09625 - 2003973..2004068 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  DA378_RS09630 phrC 2004218..2004337 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  DA378_RS09635 rapC 2004321..2005469 (-) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  DA378_RS09640 - 2005622..2007055 (-) 1434 WP_162130794.1 HAMP domain-containing sensor histidine kinase -
  DA378_RS09645 - 2007042..2007725 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=284997 DA378_RS09630 WP_003156334.1 2004218..2004337(-) (phrC) [Bacillus velezensis strain J7-1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=284997 DA378_RS09630 WP_003156334.1 2004218..2004337(-) (phrC) [Bacillus velezensis strain J7-1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment