Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   EGX78_RS00820 Genome accession   NZ_CP033767
Coordinates   131932..132216 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain FDAARGOS_534     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 126932..137216
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGX78_RS00795 (EGX78_00795) - 128878..129243 (+) 366 WP_002986560.1 DUF1033 family protein -
  EGX78_RS00800 (EGX78_00800) comGA 129336..130274 (+) 939 WP_002987773.1 competence type IV pilus ATPase ComGA Machinery gene
  EGX78_RS00805 (EGX78_00805) comGB 130210..131244 (+) 1035 WP_223845212.1 competence type IV pilus assembly protein ComGB Machinery gene
  EGX78_RS00810 (EGX78_00810) comGC 131246..131572 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  EGX78_RS00815 (EGX78_00815) comGD 131547..131975 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  EGX78_RS00820 (EGX78_00820) comGE 131932..132216 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  EGX78_RS00825 (EGX78_00825) comGF 132209..132643 (+) 435 WP_002987783.1 competence type IV pilus minor pilin ComGF Machinery gene
  EGX78_RS00830 (EGX78_00830) comGG 132627..132953 (+) 327 WP_002987787.1 competence type IV pilus minor pilin ComGG -
  EGX78_RS00835 (EGX78_00835) comGH 133051..134004 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  EGX78_RS00840 (EGX78_00840) - 134063..135259 (+) 1197 WP_123949427.1 acetate kinase -
  EGX78_RS00845 (EGX78_00845) - 135446..135754 (+) 309 WP_032461811.1 hypothetical protein -
  EGX78_RS00850 (EGX78_00850) proC 135837..136607 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=284495 EGX78_RS00820 WP_002987779.1 131932..132216(+) (comGE) [Streptococcus pyogenes strain FDAARGOS_534]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=284495 EGX78_RS00820 WP_002987779.1 131932..132216(+) (comGE) [Streptococcus pyogenes strain FDAARGOS_534]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383