Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPSH_RS00195 Genome accession   NC_010698
Coordinates   35512..35625 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori Shi470     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30512..40625
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSH_RS00170 (HPSH_00165) - 30565..32787 (+) 2223 WP_001051542.1 AAA family ATPase -
  HPSH_RS00175 (HPSH_00170) panD 32777..33127 (+) 351 WP_000142296.1 aspartate 1-decarboxylase -
  HPSH_RS00180 (HPSH_00175) - 33138..33440 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HPSH_RS00185 (HPSH_00180) - 33440..34435 (+) 996 WP_000468449.1 PDZ domain-containing protein -
  HPSH_RS00190 (HPSH_00185) comB6 34441..35496 (+) 1056 WP_000786693.1 P-type conjugative transfer protein TrbL Machinery gene
  HPSH_RS00195 (HPSH_00190) comB7 35512..35625 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  HPSH_RS00200 (HPSH_00195) comB8 35622..36365 (+) 744 WP_000660503.1 type IV secretion system protein Machinery gene
  HPSH_RS00205 (HPSH_00200) comB9 36365..37330 (+) 966 WP_012443264.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSH_RS00210 (HPSH_00205) comB10 37323..38459 (+) 1137 WP_001045866.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSH_RS00215 (HPSH_00210) - 38530..39942 (+) 1413 WP_000694833.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=28357 HPSH_RS00195 WP_001218100.1 35512..35625(+) (comB7) [Helicobacter pylori Shi470]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=28357 HPSH_RS00195 WP_001218100.1 35512..35625(+) (comB7) [Helicobacter pylori Shi470]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892


Multiple sequence alignment