Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   C7M27_RS05710 Genome accession   NZ_CP028213
Coordinates   1111449..1111823 (+) Length   124 a.a.
NCBI ID   WP_064671036.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102749     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1106449..1116823
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M27_RS05670 (C7M27_01116) corA 1106518..1107471 (+) 954 WP_004399136.1 magnesium transporter CorA -
  C7M27_RS05675 (C7M27_01117) - 1107473..1107655 (+) 183 WP_033884706.1 hypothetical protein -
  C7M27_RS05680 (C7M27_01119) comGA 1107883..1108953 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  C7M27_RS05685 (C7M27_01120) comGB 1108940..1109977 (+) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  C7M27_RS05690 (C7M27_01121) comGC 1109991..1110287 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C7M27_RS05695 (C7M27_01122) comGD 1110277..1110708 (+) 432 WP_032726159.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M27_RS05700 (C7M27_01123) comGE 1110692..1111039 (+) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  C7M27_RS05705 (C7M27_01124) comGF 1111065..1111448 (+) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C7M27_RS05710 (C7M27_01125) comGG 1111449..1111823 (+) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  C7M27_RS05715 (C7M27_01126) spoIITA 1111895..1112074 (+) 180 WP_014480252.1 YqzE family protein -
  C7M27_RS05720 (C7M27_01127) yqzG 1112116..1112442 (-) 327 WP_021480018.1 YqzG/YhdC family protein -
  C7M27_RS05725 (C7M27_01128) tapA 1112713..1113474 (+) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  C7M27_RS05730 (C7M27_01129) sipW 1113458..1114030 (+) 573 WP_003246088.1 signal peptidase I SipW -
  C7M27_RS05735 (C7M27_01130) tasA 1114095..1114880 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  C7M27_RS05740 (C7M27_01131) sinR 1114972..1115307 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M27_RS05745 (C7M27_01132) sinI 1115341..1115514 (-) 174 WP_014477323.1 anti-repressor SinI Regulator
  C7M27_RS05750 (C7M27_01133) yqhG 1115698..1116492 (-) 795 WP_032726154.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14538.80 Da        Isoelectric Point: 9.7778

>NTDB_id=283175 C7M27_RS05710 WP_064671036.1 1111449..1111823(+) (comGG) [Bacillus subtilis strain SRCM102749]
MYRTRGFIYPAVLFVSALVLLIVNFAAVQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEERKGQKGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=283175 C7M27_RS05710 WP_064671036.1 1111449..1111823(+) (comGG) [Bacillus subtilis strain SRCM102749]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGTTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGAAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment