Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   C7M21_RS10885 Genome accession   NZ_CP028207
Coordinates   2123621..2123887 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102743     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2118621..2128887
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M21_RS10865 (C7M21_02175) - 2118886..2120187 (-) 1302 WP_012117986.1 hemolysin family protein -
  C7M21_RS10870 (C7M21_02176) - 2120333..2121283 (+) 951 WP_160223176.1 magnesium transporter CorA family protein -
  C7M21_RS10875 (C7M21_02177) comGA 2121480..2122550 (+) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  C7M21_RS10880 (C7M21_02178) comGB 2122537..2123574 (+) 1038 WP_061582071.1 competence type IV pilus assembly protein ComGB Machinery gene
  C7M21_RS10885 (C7M21_02179) comGC 2123621..2123887 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  C7M21_RS10890 (C7M21_02180) comGD 2123877..2124314 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M21_RS10895 (C7M21_02181) comGE 2124298..2124612 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  C7M21_RS10900 (C7M21_02182) comGF 2124521..2125021 (+) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  C7M21_RS10905 (C7M21_02183) comGG 2125022..2125399 (+) 378 WP_160223175.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M21_RS10910 (C7M21_02184) - 2125456..2125635 (+) 180 WP_160223174.1 YqzE family protein -
  C7M21_RS10915 (C7M21_02185) - 2125675..2126004 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M21_RS10920 (C7M21_02186) tapA 2126263..2126934 (+) 672 WP_160223173.1 amyloid fiber anchoring/assembly protein TapA -
  C7M21_RS10925 (C7M21_02187) sipW 2126906..2127490 (+) 585 WP_160223172.1 signal peptidase I SipW -
  C7M21_RS10930 (C7M21_02188) tasA 2127555..2128340 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M21_RS10935 (C7M21_02189) sinR 2128388..2128723 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=282729 C7M21_RS10885 WP_042635730.1 2123621..2123887(+) (comGC) [Bacillus velezensis strain SRCM102743]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=282729 C7M21_RS10885 WP_042635730.1 2123621..2123887(+) (comGC) [Bacillus velezensis strain SRCM102743]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAGGGCTGTGAAGGACTGCAGAATATGGTGAAAGCTCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAAAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment