Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   DA787_RS16300 Genome accession   NZ_CP033205
Coordinates   3115976..3116116 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MBI 600     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3110976..3121116
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA787_RS16275 (DA787_16260) yuxO 3111289..3111669 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  DA787_RS16280 (DA787_16265) comA 3111688..3112332 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  DA787_RS16285 (DA787_16270) comP 3112413..3114722 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  DA787_RS16290 (DA787_16275) comX 3114737..3114904 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  DA787_RS16295 (DA787_16280) comQ 3114892..3115791 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  DA787_RS16300 (DA787_16285) degQ 3115976..3116116 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  DA787_RS16305 (DA787_16290) - 3116338..3116463 (+) 126 WP_003228793.1 hypothetical protein -
  DA787_RS16310 (DA787_16295) - 3116577..3116945 (+) 369 WP_003243784.1 hypothetical protein -
  DA787_RS16315 (DA787_16300) pdeH 3116921..3118150 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  DA787_RS16320 (DA787_16305) pncB 3118287..3119759 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  DA787_RS16325 (DA787_16310) pncA 3119775..3120326 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  DA787_RS16330 (DA787_16315) yueI 3120423..3120821 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=282622 DA787_RS16300 WP_003220708.1 3115976..3116116(-) (degQ) [Bacillus subtilis strain MBI 600]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=282622 DA787_RS16300 WP_003220708.1 3115976..3116116(-) (degQ) [Bacillus subtilis strain MBI 600]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1