Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C7M19_RS03395 | Genome accession | NZ_CP028205 |
| Coordinates | 776424..776597 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM102741 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 771424..781597
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M19_RS03380 (C7M19_00693) | gcvT | 772237..773337 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| C7M19_RS03385 (C7M19_00694) | - | 773761..775431 (+) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| C7M19_RS03390 (C7M19_00695) | - | 775453..776247 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| C7M19_RS03395 (C7M19_00696) | sinI | 776424..776597 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| C7M19_RS03400 (C7M19_00697) | sinR | 776631..776966 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C7M19_RS03405 (C7M19_00698) | tasA | 777014..777799 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C7M19_RS03410 (C7M19_00699) | sipW | 777864..778448 (-) | 585 | WP_160223172.1 | signal peptidase I SipW | - |
| C7M19_RS03415 (C7M19_00700) | tapA | 778420..779091 (-) | 672 | WP_160223173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C7M19_RS03420 (C7M19_00701) | - | 779350..779679 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C7M19_RS03425 (C7M19_00702) | - | 779719..779898 (-) | 180 | WP_160223174.1 | YqzE family protein | - |
| C7M19_RS03430 (C7M19_00703) | comGG | 779955..780332 (-) | 378 | WP_160223175.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C7M19_RS03435 (C7M19_00704) | comGF | 780333..780833 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| C7M19_RS03440 (C7M19_00705) | comGE | 780742..781056 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| C7M19_RS03445 (C7M19_00706) | comGD | 781040..781477 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=282538 C7M19_RS03395 WP_003153105.1 776424..776597(+) (sinI) [Bacillus velezensis strain SRCM102741]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=282538 C7M19_RS03395 WP_003153105.1 776424..776597(+) (sinI) [Bacillus velezensis strain SRCM102741]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |