Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   I3O_RS05430 Genome accession   NZ_CP028117
Coordinates   1083686..1084270 (+) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli O111 str. RM9322     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1067431..1106165 1083686..1084270 within 0


Gene organization within MGE regions


Location: 1067431..1106165
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3O_RS05360 (I3O_05350) zapC 1068455..1068997 (+) 543 WP_001295353.1 cell division protein ZapC -
  I3O_RS05365 (I3O_05355) ycbX 1068994..1070103 (-) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  I3O_RS05370 (I3O_05360) rlmKL 1070347..1072455 (+) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  I3O_RS05375 (I3O_05365) uup 1072467..1074374 (+) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  I3O_RS05380 (I3O_05370) pqiA 1074504..1075757 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  I3O_RS05385 (I3O_05375) pqiB 1075762..1077402 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  I3O_RS05390 (I3O_05380) pqiC 1077399..1077962 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  I3O_RS05395 (I3O_05385) rmf 1078218..1078385 (+) 168 WP_000828648.1 ribosome modulation factor -
  I3O_RS05400 (I3O_05390) fabA 1078455..1078973 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  I3O_RS05405 (I3O_05395) ycbZ 1079042..1080802 (-) 1761 WP_000156528.1 Lon protease family protein -
  I3O_RS05410 (I3O_05400) matP 1080988..1081440 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  I3O_RS05415 (I3O_05405) ompA 1081516..1082556 (-) 1041 WP_000750416.1 porin OmpA -
  I3O_RS05425 (I3O_05415) sulA 1082913..1083422 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  I3O_RS05430 (I3O_05420) sxy/tfoX 1083686..1084270 (+) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  I3O_RS05435 (I3O_05425) yccS 1084233..1086395 (-) 2163 WP_000875023.1 YccS family putative transporter -
  I3O_RS05440 (I3O_05430) yccF 1086405..1086851 (-) 447 WP_001261235.1 YccF domain-containing protein -
  I3O_RS05445 (I3O_05435) helD 1086974..1089028 (+) 2055 WP_001297106.1 DNA helicase IV -
  I3O_RS05450 (I3O_05440) mgsA 1089060..1089518 (-) 459 WP_000424181.1 methylglyoxal synthase -
  I3O_RS05455 (I3O_05445) yccT 1089614..1090276 (-) 663 WP_000847791.1 DUF2057 family protein -
  I3O_RS05460 (I3O_05450) yccU 1090449..1090862 (+) 414 WP_000665217.1 CoA-binding protein -
  I3O_RS05465 (I3O_05455) hspQ 1090907..1091224 (-) 318 WP_001295356.1 heat shock protein HspQ -
  I3O_RS05470 (I3O_05460) rlmI 1091282..1092472 (-) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  I3O_RS05475 (I3O_05465) yccX 1092567..1092845 (+) 279 WP_000048244.1 acylphosphatase -
  I3O_RS05480 (I3O_05470) tusE 1092842..1093171 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  I3O_RS05485 (I3O_05475) yccA 1093262..1093921 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  I3O_RS05490 (I3O_05480) - 1094333..1095348 (-) 1016 Protein_1011 tyrosine-type recombinase/integrase -
  I3O_RS28120 - 1095326..1095568 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  I3O_RS05495 (I3O_05485) - 1095636..1096688 (-) 1053 Protein_1013 3'-5' exoribonuclease -
  I3O_RS05505 (I3O_05495) - 1097999..1099420 (-) 1422 Protein_1015 exonuclease -
  I3O_RS05510 (I3O_05500) - 1099513..1099704 (-) 192 WP_001090200.1 DUF1482 family protein -
  I3O_RS05515 (I3O_05505) dicB 1099701..1099889 (-) 189 WP_000449192.1 cell division inhibition protein DicB -
  I3O_RS05525 (I3O_05515) - 1100421..1100795 (-) 375 WP_000394557.1 hypothetical protein -
  I3O_RS05530 (I3O_05520) - 1100807..1100959 (-) 153 WP_000379580.1 DUF1391 family protein -
  I3O_RS05540 (I3O_05530) - 1101232..1101948 (-) 717 WP_000103686.1 S24 family peptidase -
  I3O_RS05545 (I3O_05535) - 1101998..1102213 (+) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  I3O_RS05550 (I3O_05540) - 1102210..1102635 (+) 426 WP_000693949.1 toxin YdaT family protein -
  I3O_RS05555 (I3O_05545) - 1102707..1103777 (+) 1071 WP_001262389.1 hypothetical protein -
  I3O_RS05560 (I3O_05550) - 1103818..1104240 (+) 423 WP_001151153.1 DUF977 family protein -
  I3O_RS05565 (I3O_05555) - 1104237..1104533 (+) 297 WP_001266135.1 DUF4406 domain-containing protein -
  I3O_RS05570 (I3O_05560) - 1104530..1104991 (+) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  I3O_RS05575 (I3O_05565) - 1104969..1105325 (+) 357 WP_000403777.1 hypothetical protein -
  I3O_RS05580 (I3O_05570) - 1105376..1105588 (+) 213 WP_000935420.1 hypothetical protein -
  I3O_RS05585 (I3O_05575) - 1105621..1105838 (+) 218 Protein_1029 DUF4014 family protein -
  I3O_RS05590 (I3O_05580) - 1105840..1106103 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=281311 I3O_RS05430 WP_077825616.1 1083686..1084270(+) (sxy/tfoX) [Escherichia coli O111 str. RM9322]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=281311 I3O_RS05430 WP_077825616.1 1083686..1084270(+) (sxy/tfoX) [Escherichia coli O111 str. RM9322]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment