Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   I3Q_RS14830 Genome accession   NZ_CP028112
Coordinates   2647686..2648315 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli O103 str. RM8385     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2622491..2660818 2647686..2648315 within 0


Gene organization within MGE regions


Location: 2622491..2660818
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3Q_RS14625 (I3Q_14625) - 2622712..2622984 (-) 273 WP_001342259.1 hypothetical protein -
  I3Q_RS14630 (I3Q_14630) - 2623120..2623377 (+) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  I3Q_RS14635 (I3Q_14635) - 2623383..2623682 (+) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  I3Q_RS14640 (I3Q_14640) - 2623887..2624231 (-) 345 WP_000206830.1 hypothetical protein -
  I3Q_RS14645 (I3Q_14645) - 2624228..2624593 (-) 366 WP_001229296.1 HNH endonuclease signature motif containing protein -
  I3Q_RS14650 (I3Q_14650) - 2624595..2624813 (-) 219 WP_000209152.1 DUF4014 family protein -
  I3Q_RS14655 (I3Q_14655) - 2625039..2625536 (-) 498 Protein_2715 ead/Ea22-like family protein -
  I3Q_RS31700 - 2625533..2625709 (-) 177 WP_000753069.1 hypothetical protein -
  I3Q_RS14660 (I3Q_14660) - 2625702..2625884 (-) 183 WP_001224662.1 hypothetical protein -
  I3Q_RS14665 (I3Q_14665) - 2625918..2626130 (-) 213 WP_000935422.1 hypothetical protein -
  I3Q_RS14670 (I3Q_14670) - 2626181..2626537 (-) 357 WP_000403783.1 hypothetical protein -
  I3Q_RS14675 (I3Q_14675) - 2626515..2626976 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  I3Q_RS14680 (I3Q_14680) - 2626973..2627269 (-) 297 WP_001266133.1 DUF4406 domain-containing protein -
  I3Q_RS14685 (I3Q_14685) - 2627266..2627658 (-) 393 WP_001040234.1 DUF977 family protein -
  I3Q_RS14690 (I3Q_14690) - 2627674..2628399 (-) 726 WP_000450641.1 DUF1627 domain-containing protein -
  I3Q_RS14695 (I3Q_14695) - 2628433..2628894 (-) 462 WP_000139444.1 replication protein P -
  I3Q_RS31380 - 2628887..2629897 (-) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  I3Q_RS14705 (I3Q_14705) - 2629984..2630421 (-) 438 WP_000693932.1 toxin YdaT family protein -
  I3Q_RS14710 (I3Q_14710) - 2630418..2630678 (-) 261 WP_001172789.1 YdaS family helix-turn-helix protein -
  I3Q_RS14715 (I3Q_14715) - 2630805..2631197 (+) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  I3Q_RS14720 (I3Q_14720) - 2631244..2631603 (-) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  I3Q_RS14725 (I3Q_14725) - 2631606..2631908 (-) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  I3Q_RS31705 (I3Q_14735) - 2632244..2632543 (+) 300 WP_012817750.1 hypothetical protein -
  I3Q_RS14740 (I3Q_14740) ydfC 2632615..2632833 (+) 219 WP_001171921.1 protein YdfC -
  I3Q_RS14750 (I3Q_14750) dicB 2633402..2633590 (+) 189 WP_000449175.1 cell division inhibition protein DicB -
  I3Q_RS14755 (I3Q_14755) - 2633587..2633775 (+) 189 WP_000199475.1 DUF1482 family protein -
  I3Q_RS14760 (I3Q_14760) - 2633870..2636320 (+) 2451 WP_000048499.1 exonuclease -
  I3Q_RS14765 (I3Q_14765) - 2636388..2636630 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  I3Q_RS14770 (I3Q_14770) - 2636608..2637627 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  I3Q_RS14775 (I3Q_14775) yccA 2638035..2638694 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  I3Q_RS14780 (I3Q_14780) tusE 2638785..2639114 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  I3Q_RS14785 (I3Q_14785) yccX 2639111..2639389 (-) 279 WP_000048244.1 acylphosphatase -
  I3Q_RS14790 (I3Q_14790) rlmI 2639484..2640674 (+) 1191 WP_000116304.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  I3Q_RS14795 (I3Q_14795) hspQ 2640732..2641049 (+) 318 WP_001295356.1 heat shock protein HspQ -
  I3Q_RS14800 (I3Q_14800) yccU 2641094..2641507 (-) 414 WP_000665217.1 CoA-binding protein -
  I3Q_RS14805 (I3Q_14805) yccT 2641680..2642342 (+) 663 WP_000847791.1 DUF2057 family protein -
  I3Q_RS14810 (I3Q_14810) mgsA 2642438..2642896 (+) 459 WP_000424181.1 methylglyoxal synthase -
  I3Q_RS14815 (I3Q_14815) helD 2642928..2644982 (-) 2055 WP_001297106.1 DNA helicase IV -
  I3Q_RS14820 (I3Q_14820) yccF 2645105..2645551 (+) 447 WP_001261235.1 YccF domain-containing protein -
  I3Q_RS14825 (I3Q_14825) yccS 2645561..2647723 (+) 2163 WP_000875023.1 YccS family putative transporter -
  I3Q_RS14830 (I3Q_14830) sxy/tfoX 2647686..2648315 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  I3Q_RS14835 (I3Q_14835) sulA 2648534..2649043 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  I3Q_RS14845 (I3Q_14845) ompA 2649400..2650440 (+) 1041 WP_000750416.1 porin OmpA -
  I3Q_RS14850 (I3Q_14850) matP 2650515..2650967 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  I3Q_RS14855 (I3Q_14855) ycbZ 2651153..2652913 (+) 1761 WP_000156528.1 Lon protease family protein -
  I3Q_RS14860 (I3Q_14860) fabA 2652982..2653500 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  I3Q_RS14865 (I3Q_14865) rmf 2653570..2653737 (-) 168 WP_000828648.1 ribosome modulation factor -
  I3Q_RS14870 (I3Q_14870) pqiC 2653993..2654556 (-) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  I3Q_RS14875 (I3Q_14875) pqiB 2654553..2656193 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  I3Q_RS14880 (I3Q_14880) pqiA 2656198..2657451 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  I3Q_RS14885 (I3Q_14885) uup 2657581..2659488 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=281270 I3Q_RS14830 WP_000839153.1 2647686..2648315(-) (sxy/tfoX) [Escherichia coli O103 str. RM8385]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=281270 I3Q_RS14830 WP_000839153.1 2647686..2648315(-) (sxy/tfoX) [Escherichia coli O103 str. RM8385]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment