Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   I3S_RS05215 Genome accession   NZ_CP028110
Coordinates   1061247..1061876 (+) Length   209 a.a.
NCBI ID   WP_000841914.1    Uniprot ID   A0AAP9MNK0
Organism   Escherichia coli O121 str. RM8352     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1045028..1082635 1061247..1061876 within 0


Gene organization within MGE regions


Location: 1045028..1082635
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3S_RS05145 (I3S_05135) zapC 1046052..1046594 (+) 543 WP_001338438.1 cell division protein ZapC -
  I3S_RS05150 (I3S_05140) ycbX 1046591..1047700 (-) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  I3S_RS05155 (I3S_05145) rlmKL 1047943..1050051 (+) 2109 WP_001086532.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  I3S_RS05160 (I3S_05150) uup 1050063..1051970 (+) 1908 WP_000053123.1 ABC transporter ATP-binding protein -
  I3S_RS05165 (I3S_05155) pqiA 1052100..1053353 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  I3S_RS05170 (I3S_05160) pqiB 1053358..1054998 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  I3S_RS05175 (I3S_05165) pqiC 1054995..1055558 (+) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  I3S_RS05180 (I3S_05170) rmf 1055813..1055980 (+) 168 WP_000828648.1 ribosome modulation factor -
  I3S_RS05185 (I3S_05175) fabA 1056050..1056568 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  I3S_RS05190 (I3S_05180) ycbZ 1056637..1058397 (-) 1761 WP_000156526.1 Lon protease family protein -
  I3S_RS05195 (I3S_05185) matP 1058583..1059035 (+) 453 WP_000877158.1 macrodomain Ter protein MatP -
  I3S_RS05200 (I3S_05190) ompA 1059110..1060162 (-) 1053 WP_000750419.1 porin OmpA -
  I3S_RS05210 (I3S_05200) sulA 1060519..1061028 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  I3S_RS05215 (I3S_05205) sxy/tfoX 1061247..1061876 (+) 630 WP_000841914.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  I3S_RS05220 (I3S_05210) yccS 1061839..1064001 (-) 2163 WP_000875061.1 YccS family putative transporter -
  I3S_RS05225 (I3S_05215) yccF 1064011..1064457 (-) 447 WP_001261235.1 YccF domain-containing protein -
  I3S_RS05230 (I3S_05220) helD 1064580..1066634 (+) 2055 WP_001295354.1 DNA helicase IV -
  I3S_RS05235 (I3S_05225) mgsA 1066666..1067124 (-) 459 WP_000424181.1 methylglyoxal synthase -
  I3S_RS05240 (I3S_05230) yccT 1067220..1067882 (-) 663 WP_000847791.1 DUF2057 family protein -
  I3S_RS05245 (I3S_05235) yccU 1068055..1068468 (+) 414 WP_000665217.1 CoA-binding protein -
  I3S_RS05250 (I3S_05240) hspQ 1068513..1068830 (-) 318 WP_001295356.1 heat shock protein HspQ -
  I3S_RS05255 (I3S_05245) rlmI 1068888..1070078 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  I3S_RS05260 (I3S_05250) yccX 1070173..1070451 (+) 279 WP_000048233.1 acylphosphatase -
  I3S_RS05265 (I3S_05255) tusE 1070448..1070777 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  I3S_RS05270 (I3S_05260) yccA 1070868..1071527 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  I3S_RS05275 (I3S_05265) - 1071935..1072954 (-) 1020 WP_001370339.1 tyrosine-type recombinase/integrase -
  I3S_RS05280 (I3S_05270) - 1072932..1073174 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  I3S_RS05285 (I3S_05275) - 1073242..1075677 (-) 2436 WP_032212635.1 exonuclease -
  I3S_RS05290 (I3S_05280) - 1075758..1075961 (-) 204 WP_001098749.1 DUF1482 family protein -
  I3S_RS05295 (I3S_05285) dicB 1075964..1076146 (-) 183 WP_000449182.1 cell division inhibition protein DicB -
  I3S_RS05305 (I3S_05295) - 1076892..1077281 (-) 390 WP_000394568.1 hypothetical protein -
  I3S_RS05310 (I3S_05300) - 1077293..1077445 (-) 153 WP_000379585.1 DUF1391 family protein -
  I3S_RS05315 (I3S_05305) racR 1077761..1078237 (-) 477 WP_000948459.1 DNA-binding transcriptional repressor RacR -
  I3S_RS05320 (I3S_05310) ydaS 1078361..1078657 (+) 297 WP_000712069.1 toxin YdaS -
  I3S_RS05325 (I3S_05315) - 1078680..1079105 (+) 426 WP_000693884.1 toxin YdaT family protein -
  I3S_RS05330 (I3S_05320) - 1079177..1080247 (+) 1071 WP_001262384.1 hypothetical protein -
  I3S_RS05335 (I3S_05325) - 1080288..1080710 (+) 423 WP_001151153.1 DUF977 family protein -
  I3S_RS05340 (I3S_05330) - 1080707..1081003 (+) 297 WP_001266134.1 DUF4406 domain-containing protein -
  I3S_RS05345 (I3S_05335) - 1081000..1081461 (+) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  I3S_RS05350 (I3S_05340) - 1081439..1081795 (+) 357 WP_000403777.1 hypothetical protein -
  I3S_RS05355 (I3S_05345) - 1081846..1082058 (+) 213 WP_000935420.1 hypothetical protein -
  I3S_RS05360 (I3S_05350) - 1082091..1082308 (+) 218 Protein_985 DUF4014 family protein -
  I3S_RS05365 (I3S_05355) - 1082310..1082573 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24130.97 Da        Isoelectric Point: 9.2180

>NTDB_id=281247 I3S_RS05215 WP_000841914.1 1061247..1061876(+) (sxy/tfoX) [Escherichia coli O121 str. RM8352]
MKSPSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=281247 I3S_RS05215 WP_000841914.1 1061247..1061876(+) (sxy/tfoX) [Escherichia coli O121 str. RM8352]
ATGAAAAGCCCCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995

Multiple sequence alignment