Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4G81_RS01125 Genome accession   NZ_CP032913
Coordinates   235642..235755 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 5-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 230642..240755
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4G81_RS01100 - 230690..232915 (+) 2226 WP_139523929.1 ATP-dependent Clp protease ATP-binding subunit -
  D4G81_RS01105 panD 232905..233255 (+) 351 WP_139523930.1 aspartate 1-decarboxylase -
  D4G81_RS01110 - 233266..233568 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  D4G81_RS01115 - 233568..234563 (+) 996 WP_139524912.1 PDZ domain-containing protein -
  D4G81_RS01120 comB6 234571..235626 (+) 1056 WP_139524911.1 P-type conjugative transfer protein TrbL Machinery gene
  D4G81_RS01125 comB7 235642..235755 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4G81_RS01130 comB8 235752..236495 (+) 744 WP_108243229.1 virB8 family protein Machinery gene
  D4G81_RS01135 comB9 236495..237490 (+) 996 WP_139523931.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4G81_RS01140 comB10 237483..238613 (+) 1131 WP_139523932.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4G81_RS01145 - 238678..240090 (+) 1413 WP_139523933.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=281105 D4G81_RS01125 WP_001217873.1 235642..235755(+) (comB7) [Helicobacter pylori strain 5-A-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=281105 D4G81_RS01125 WP_001217873.1 235642..235755(+) (comB7) [Helicobacter pylori strain 5-A-EK1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAACCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1