Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   C7J89_RS10865 Genome accession   NZ_CP027846
Coordinates   2178438..2179001 (-) Length   187 a.a.
NCBI ID   WP_061855517.1    Uniprot ID   -
Organism   Staphylococcus kloosii strain ATCC 43959     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2138282..2178072 2178438..2179001 flank 366


Gene organization within MGE regions


Location: 2138282..2179001
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7J89_RS10550 (C7J89_10545) - 2138282..2139760 (-) 1479 WP_103295241.1 SH3 domain-containing protein -
  C7J89_RS10555 (C7J89_10550) - 2139747..2140229 (-) 483 WP_103295242.1 phage holin -
  C7J89_RS10560 (C7J89_10555) - 2140272..2140667 (-) 396 WP_103295243.1 hypothetical protein -
  C7J89_RS10565 (C7J89_10560) - 2140654..2141076 (-) 423 WP_103295244.1 hypothetical protein -
  C7J89_RS10570 (C7J89_10565) - 2141113..2141271 (-) 159 WP_103295245.1 XkdX family protein -
  C7J89_RS10575 (C7J89_10570) - 2141246..2141650 (-) 405 WP_103295246.1 DUF2977 domain-containing protein -
  C7J89_RS10580 (C7J89_10575) - 2141650..2143134 (-) 1485 WP_103295247.1 BppU family phage baseplate upper protein -
  C7J89_RS10585 (C7J89_10580) - 2143148..2145085 (-) 1938 WP_103295248.1 hypothetical protein -
  C7J89_RS10590 (C7J89_10585) - 2145109..2145387 (-) 279 WP_103295249.1 hypothetical protein -
  C7J89_RS10595 (C7J89_10590) - 2145403..2146995 (-) 1593 WP_103295250.1 prophage endopeptidase tail family protein -
  C7J89_RS10600 (C7J89_10595) - 2147004..2147828 (-) 825 WP_103295251.1 phage tail domain-containing protein -
  C7J89_RS10605 (C7J89_10600) - 2147828..2152354 (-) 4527 WP_103295252.1 peptidoglycan DD-metalloendopeptidase family protein -
  C7J89_RS13325 gpGT 2152384..2152524 (-) 141 WP_170066447.1 phage tail assembly chaperone GT -
  C7J89_RS10610 (C7J89_10605) gpG 2152569..2152931 (-) 363 WP_103295253.1 phage tail assembly chaperone G -
  C7J89_RS10615 (C7J89_10610) - 2153004..2153498 (-) 495 WP_103295254.1 Ig-like domain-containing protein -
  C7J89_RS10620 (C7J89_10615) - 2153592..2154188 (-) 597 WP_103295255.1 major tail protein -
  C7J89_RS10625 (C7J89_10620) - 2154201..2154605 (-) 405 WP_103295256.1 hypothetical protein -
  C7J89_RS10630 (C7J89_10625) - 2154606..2155016 (-) 411 WP_103295257.1 hypothetical protein -
  C7J89_RS10635 (C7J89_10630) - 2155013..2155342 (-) 330 WP_103295258.1 hypothetical protein -
  C7J89_RS10640 (C7J89_10635) - 2155332..2155673 (-) 342 WP_103295259.1 head-tail connector protein -
  C7J89_RS10645 (C7J89_10640) - 2155745..2157088 (-) 1344 WP_103295260.1 phage major capsid protein -
  C7J89_RS10650 (C7J89_10645) - 2157131..2157688 (-) 558 WP_103295261.1 HK97 family phage prohead protease -
  C7J89_RS10655 (C7J89_10650) - 2157675..2158910 (-) 1236 WP_103295262.1 phage portal protein -
  C7J89_RS10660 (C7J89_10655) - 2158913..2159098 (-) 186 WP_103295263.1 hypothetical protein -
  C7J89_RS10665 (C7J89_10660) - 2159111..2160841 (-) 1731 WP_371860673.1 terminase large subunit -
  C7J89_RS10670 (C7J89_10665) - 2160831..2161316 (-) 486 WP_103295265.1 phage terminase small subunit P27 family -
  C7J89_RS10675 (C7J89_10670) - 2161466..2161816 (-) 351 WP_103295266.1 HNH endonuclease -
  C7J89_RS10680 (C7J89_10675) - 2162415..2162831 (-) 417 WP_103295844.1 DUF722 domain-containing protein -
  C7J89_RS10685 (C7J89_10680) - 2162845..2163057 (-) 213 WP_103295843.1 hypothetical protein -
  C7J89_RS10690 (C7J89_10685) rinB 2163059..2163247 (-) 189 WP_103295842.1 transcriptional activator RinB -
  C7J89_RS13525 - 2163248..2163463 (-) 216 WP_106884410.1 DUF1381 domain-containing protein -
  C7J89_RS10700 (C7J89_10695) - 2163500..2164006 (-) 507 WP_103295841.1 dUTP diphosphatase -
  C7J89_RS10705 (C7J89_10700) - 2164008..2164280 (-) 273 WP_103295840.1 hypothetical protein -
  C7J89_RS10710 (C7J89_10705) - 2164277..2164516 (-) 240 WP_103295839.1 hypothetical protein -
  C7J89_RS10715 (C7J89_10710) - 2164513..2164758 (-) 246 WP_103295838.1 hypothetical protein -
  C7J89_RS13595 (C7J89_10715) - 2164764..2164958 (-) 195 WP_103295837.1 SAV1978 family virulence-associated passenger protein -
  C7J89_RS10725 (C7J89_10720) - 2164955..2165188 (-) 234 WP_103295836.1 hypothetical protein -
  C7J89_RS10730 (C7J89_10725) - 2165191..2165412 (-) 222 WP_103295835.1 DUF3310 domain-containing protein -
  C7J89_RS10735 (C7J89_10730) - 2165412..2165606 (-) 195 WP_103295834.1 hypothetical protein -
  C7J89_RS10740 (C7J89_10735) - 2165608..2166000 (-) 393 WP_103295833.1 hypothetical protein -
  C7J89_RS10745 (C7J89_10740) - 2166003..2166194 (-) 192 WP_103295832.1 hypothetical protein -
  C7J89_RS10750 (C7J89_10745) - 2166200..2166601 (-) 402 WP_103295831.1 DUF1064 domain-containing protein -
  C7J89_RS10755 (C7J89_10750) - 2166615..2166863 (-) 249 WP_103295830.1 hypothetical protein -
  C7J89_RS10760 (C7J89_10755) - 2166860..2167060 (-) 201 WP_103295829.1 hypothetical protein -
  C7J89_RS10765 (C7J89_10760) - 2167057..2168289 (-) 1233 WP_371860674.1 DnaB helicase C-terminal domain-containing protein -
  C7J89_RS10770 (C7J89_10765) - 2168282..2168650 (-) 369 WP_103295827.1 hypothetical protein -
  C7J89_RS10775 (C7J89_10770) - 2168656..2169384 (-) 729 WP_103295826.1 helix-turn-helix domain-containing protein -
  C7J89_RS10780 (C7J89_10775) - 2169371..2170051 (-) 681 WP_103295825.1 putative HNHc nuclease -
  C7J89_RS10785 (C7J89_10780) - 2170065..2170448 (-) 384 WP_103295824.1 single-stranded DNA-binding protein -
  C7J89_RS10790 (C7J89_10785) - 2170448..2171104 (-) 657 WP_103295823.1 ERF family protein -
  C7J89_RS10795 (C7J89_10790) - 2171097..2171318 (-) 222 WP_103295822.1 DUF2483 family protein -
  C7J89_RS10800 (C7J89_10795) - 2171290..2171568 (-) 279 WP_103295821.1 hypothetical protein -
  C7J89_RS13245 - 2171647..2171817 (-) 171 WP_159031777.1 hypothetical protein -
  C7J89_RS10805 (C7J89_10800) - 2171829..2172038 (-) 210 WP_103295820.1 hypothetical protein -
  C7J89_RS10810 (C7J89_10805) - 2172102..2172587 (+) 486 WP_103295819.1 hypothetical protein -
  C7J89_RS10815 (C7J89_10810) - 2172729..2173478 (-) 750 WP_103295818.1 phage regulatory protein/antirepressor Ant -
  C7J89_RS10820 (C7J89_10815) - 2173520..2173720 (-) 201 WP_103295817.1 helix-turn-helix transcriptional regulator -
  C7J89_RS10825 (C7J89_10820) - 2173886..2174221 (+) 336 WP_103295816.1 helix-turn-helix transcriptional regulator -
  C7J89_RS10830 (C7J89_10825) - 2174234..2174698 (+) 465 WP_103295815.1 ImmA/IrrE family metallo-endopeptidase -
  C7J89_RS10835 (C7J89_10830) - 2174713..2175693 (+) 981 WP_103295814.1 hypothetical protein -
  C7J89_RS10840 (C7J89_10835) - 2176114..2176311 (+) 198 WP_103295813.1 hypothetical protein -
  C7J89_RS13250 - 2176312..2176614 (-) 303 WP_142381017.1 hypothetical protein -
  C7J89_RS10850 (C7J89_10845) - 2177023..2178072 (+) 1050 WP_103295811.1 site-specific integrase -
  C7J89_RS10865 (C7J89_10860) comK/comK1 2178438..2179001 (-) 564 WP_061855517.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 187 a.a.        Molecular weight: 22461.84 Da        Isoelectric Point: 9.8176

>NTDB_id=280894 C7J89_RS10865 WP_061855517.1 2178438..2179001(-) (comK/comK1) [Staphylococcus kloosii strain ATCC 43959]
MINKYVIKKGDMVVQPFDTKERKYGGTRILKYKQPTEEFKERAHKIIERSCRFYGSSYHFKKEDTIRITGIISKPPILFT
PLFPTYFFPTHSDRKDENTWINIHYVQNIKSLKDRKSKVTFVDNQFITIDISAHSMRHQYLNAIYYYYMMDREARITTFD
PDAPIDYTKPQLNIYEALAKYSLFEHK

Nucleotide


Download         Length: 564 bp        

>NTDB_id=280894 C7J89_RS10865 WP_061855517.1 2178438..2179001(-) (comK/comK1) [Staphylococcus kloosii strain ATCC 43959]
ATAATTAATAAATATGTTATTAAGAAAGGAGACATGGTAGTTCAACCGTTTGATACAAAAGAAAGAAAATATGGTGGCAC
AAGAATATTAAAATATAAGCAACCAACAGAAGAATTTAAAGAAAGAGCGCATAAAATAATTGAACGTTCGTGTCGATTTT
ACGGTAGTAGTTATCATTTTAAGAAAGAAGACACCATTCGCATCACAGGTATTATTAGTAAACCCCCAATATTATTCACT
CCGTTATTTCCCACATACTTTTTTCCAACACACTCTGATAGAAAAGACGAAAACACTTGGATCAATATTCATTATGTGCA
AAATATTAAATCACTAAAAGATAGAAAGAGTAAAGTAACTTTCGTTGATAACCAATTTATAACGATTGATATTTCTGCAC
ATAGCATGAGACATCAATATTTAAACGCTATTTACTATTATTATATGATGGATAGAGAAGCAAGGATAACTACATTTGAT
CCAGATGCACCGATCGATTATACTAAACCGCAATTAAATATTTATGAAGCTTTAGCAAAATATTCATTGTTTGAACATAA
ATAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(3-152)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

55.135

98.93

0.545
  comK/comK1 Staphylococcus aureus N315

55.135

98.93

0.545

Multiple sequence alignment