Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4K04_RS01320 Genome accession   NZ_CP032904
Coordinates   262672..262785 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 169-A-EK5     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 257672..267785
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4K04_RS01295 - 257725..259950 (+) 2226 WP_139521452.1 ATP-dependent Clp protease ATP-binding subunit -
  D4K04_RS01300 panD 259940..260293 (+) 354 WP_033599840.1 aspartate 1-decarboxylase -
  D4K04_RS01305 - 260296..260598 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  D4K04_RS01310 - 260598..261593 (+) 996 WP_139522314.1 PDZ domain-containing protein -
  D4K04_RS01315 comB6 261601..262656 (+) 1056 WP_139521454.1 P-type conjugative transfer protein TrbL Machinery gene
  D4K04_RS01320 comB7 262672..262785 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4K04_RS01325 comB8 262782..263525 (+) 744 WP_108557395.1 virB8 family protein Machinery gene
  D4K04_RS01330 comB9 263525..264523 (+) 999 WP_139521456.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4K04_RS01335 comB10 264516..265652 (+) 1137 WP_139521457.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4K04_RS01340 - 265722..267134 (+) 1413 WP_139521459.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=280728 D4K04_RS01320 WP_001217873.1 262672..262785(+) (comB7) [Helicobacter pylori strain 169-A-EK5]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=280728 D4K04_RS01320 WP_001217873.1 262672..262785(+) (comB7) [Helicobacter pylori strain 169-A-EK5]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment