Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4L20_RS01140 Genome accession   NZ_CP032899
Coordinates   232495..232608 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 478-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 227495..237608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4L20_RS01115 - 227539..229764 (+) 2226 WP_139549225.1 ATP-dependent Clp protease ATP-binding subunit -
  D4L20_RS01120 panD 229754..230107 (+) 354 WP_079342783.1 aspartate 1-decarboxylase -
  D4L20_RS01125 - 230110..230412 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  D4L20_RS01130 - 230412..231416 (+) 1005 WP_139549226.1 PDZ domain-containing protein -
  D4L20_RS01135 comB6 231424..232479 (+) 1056 WP_139549227.1 P-type conjugative transfer protein TrbL Machinery gene
  D4L20_RS01140 comB7 232495..232608 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4L20_RS01145 comB8 232605..233348 (+) 744 WP_139549228.1 virB8 family protein Machinery gene
  D4L20_RS01150 comB9 233348..234337 (+) 990 WP_139549229.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4L20_RS01155 comB10 234330..235460 (+) 1131 WP_139549230.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4L20_RS01160 - 235531..236943 (+) 1413 WP_139549231.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=280525 D4L20_RS01140 WP_001217873.1 232495..232608(+) (comB7) [Helicobacter pylori strain 478-A-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=280525 D4L20_RS01140 WP_001217873.1 232495..232608(+) (comB7) [Helicobacter pylori strain 478-A-EK1]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1