Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   C7M85_RS12310 Genome accession   NZ_CP027766
Coordinates   2166535..2167164 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 2013C-3342     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2145964..2183374 2166535..2167164 within 0


Gene organization within MGE regions


Location: 2145964..2183374
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M85_RS12160 - 2146026..2146289 (-) 264 WP_000224233.1 hypothetical protein -
  C7M85_RS12165 - 2146291..2146508 (-) 218 Protein_2247 DUF4014 family protein -
  C7M85_RS12170 - 2146541..2146753 (-) 213 WP_000935420.1 hypothetical protein -
  C7M85_RS12175 - 2146804..2147160 (-) 357 WP_000403777.1 hypothetical protein -
  C7M85_RS12180 - 2147138..2147599 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  C7M85_RS12185 - 2147596..2147892 (-) 297 WP_001266134.1 DUF4406 domain-containing protein -
  C7M85_RS12190 - 2147889..2148311 (-) 423 WP_106884040.1 DUF977 family protein -
  C7M85_RS12195 - 2148352..2149410 (-) 1059 WP_106884039.1 phage replisome organizer -
  C7M85_RS12200 - 2149482..2149907 (-) 426 WP_106910289.1 toxin YdaT family protein -
  C7M85_RS12205 - 2149904..2150119 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  C7M85_RS12210 - 2150169..2150885 (+) 717 WP_000103686.1 S24 family peptidase -
  C7M85_RS12220 ydfA 2151158..2151310 (+) 153 WP_000379580.1 DUF1391 family protein -
  C7M85_RS12225 - 2151322..2151696 (+) 375 WP_000394557.1 hypothetical protein -
  C7M85_RS12230 dicB 2152229..2152417 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  C7M85_RS12235 - 2152414..2152605 (+) 192 WP_001090200.1 DUF1482 family protein -
  C7M85_RS12240 - 2152698..2155169 (+) 2472 WP_044806223.1 exonuclease -
  C7M85_RS12245 - 2155237..2155479 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  C7M85_RS12250 - 2155457..2156476 (+) 1020 WP_001299701.1 tyrosine-type recombinase/integrase -
  C7M85_RS12255 yccA 2156884..2157543 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  C7M85_RS12260 tusE 2157634..2157963 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  C7M85_RS12265 yccX 2157960..2158238 (-) 279 WP_000048244.1 acylphosphatase -
  C7M85_RS12270 rlmI 2158333..2159523 (+) 1191 WP_106884037.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C7M85_RS12275 hspQ 2159581..2159898 (+) 318 WP_001295356.1 heat shock protein HspQ -
  C7M85_RS12280 yccU 2159943..2160356 (-) 414 WP_000665217.1 CoA-binding protein -
  C7M85_RS12285 yccT 2160529..2161191 (+) 663 WP_000847791.1 DUF2057 family protein -
  C7M85_RS12290 mgsA 2161287..2161745 (+) 459 WP_000424181.1 methylglyoxal synthase -
  C7M85_RS12295 helD 2161777..2163831 (-) 2055 WP_106910290.1 DNA helicase IV -
  C7M85_RS12300 yccF 2163954..2164400 (+) 447 WP_001261235.1 YccF domain-containing protein -
  C7M85_RS12305 yccS 2164410..2166572 (+) 2163 WP_000875023.1 YccS family putative transporter -
  C7M85_RS12310 sxy/tfoX 2166535..2167164 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C7M85_RS12315 sulA 2167383..2167892 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  C7M85_RS12325 ompA 2168249..2169289 (+) 1041 WP_001400178.1 porin OmpA -
  C7M85_RS12330 matP 2169365..2169817 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C7M85_RS12335 ycbZ 2170003..2171763 (+) 1761 WP_000156528.1 Lon protease family protein -
  C7M85_RS12340 fabA 2171832..2172350 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C7M85_RS12345 rmf 2172420..2172587 (-) 168 WP_000828648.1 ribosome modulation factor -
  C7M85_RS12350 pqiC 2172843..2173406 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  C7M85_RS12355 pqiB 2173403..2175043 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  C7M85_RS12360 pqiA 2175048..2176301 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C7M85_RS12365 uup 2176431..2178338 (-) 1908 WP_044806219.1 ABC transporter ATP-binding protein -
  C7M85_RS12370 rlmKL 2178350..2180458 (-) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  C7M85_RS12375 ycbX 2180702..2181811 (+) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  C7M85_RS12380 zapC 2181808..2182350 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=280337 C7M85_RS12310 WP_000839153.1 2166535..2167164(-) (sxy/tfoX) [Escherichia coli strain 2013C-3342]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=280337 C7M85_RS12310 WP_000839153.1 2166535..2167164(-) (sxy/tfoX) [Escherichia coli strain 2013C-3342]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment