Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D9C10_RS10750 Genome accession   NZ_CP032853
Coordinates   1951336..1951509 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain MH-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1946336..1956509
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C10_RS10735 (D9C10_10735) gcvT 1947135..1948223 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  D9C10_RS10740 (D9C10_10740) hepAA 1948665..1950338 (+) 1674 WP_014480248.1 SNF2-related protein -
  D9C10_RS10745 (D9C10_10745) yqhG 1950359..1951153 (+) 795 WP_014480249.1 YqhG family protein -
  D9C10_RS10750 (D9C10_10750) sinI 1951336..1951509 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C10_RS10755 (D9C10_10755) sinR 1951543..1951878 (+) 336 WP_121548932.1 transcriptional regulator SinR Regulator
  D9C10_RS10760 (D9C10_10760) tasA 1951971..1952756 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C10_RS10765 (D9C10_10765) sipW 1952820..1953392 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C10_RS10770 (D9C10_10770) tapA 1953376..1954137 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C10_RS10775 (D9C10_10775) yqzG 1954409..1954735 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C10_RS10780 (D9C10_10780) spoIITA 1954777..1954956 (-) 180 WP_014480252.1 YqzE family protein -
  D9C10_RS10785 (D9C10_10785) comGG 1955027..1955401 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C10_RS10790 (D9C10_10790) comGF 1955402..1955785 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C10_RS10795 (D9C10_10795) comGE 1955811..1956158 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=279030 D9C10_RS10750 WP_003230187.1 1951336..1951509(+) (sinI) [Bacillus subtilis subsp. subtilis strain MH-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=279030 D9C10_RS10750 WP_003230187.1 1951336..1951509(+) (sinI) [Bacillus subtilis subsp. subtilis strain MH-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1