Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C10_RS10750 | Genome accession | NZ_CP032853 |
| Coordinates | 1951336..1951509 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain MH-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1946336..1956509
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C10_RS10735 (D9C10_10735) | gcvT | 1947135..1948223 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9C10_RS10740 (D9C10_10740) | hepAA | 1948665..1950338 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| D9C10_RS10745 (D9C10_10745) | yqhG | 1950359..1951153 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C10_RS10750 (D9C10_10750) | sinI | 1951336..1951509 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C10_RS10755 (D9C10_10755) | sinR | 1951543..1951878 (+) | 336 | WP_121548932.1 | transcriptional regulator SinR | Regulator |
| D9C10_RS10760 (D9C10_10760) | tasA | 1951971..1952756 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C10_RS10765 (D9C10_10765) | sipW | 1952820..1953392 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C10_RS10770 (D9C10_10770) | tapA | 1953376..1954137 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C10_RS10775 (D9C10_10775) | yqzG | 1954409..1954735 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C10_RS10780 (D9C10_10780) | spoIITA | 1954777..1954956 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C10_RS10785 (D9C10_10785) | comGG | 1955027..1955401 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C10_RS10790 (D9C10_10790) | comGF | 1955402..1955785 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| D9C10_RS10795 (D9C10_10795) | comGE | 1955811..1956158 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=279030 D9C10_RS10750 WP_003230187.1 1951336..1951509(+) (sinI) [Bacillus subtilis subsp. subtilis strain MH-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=279030 D9C10_RS10750 WP_003230187.1 1951336..1951509(+) (sinI) [Bacillus subtilis subsp. subtilis strain MH-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |