Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C09_RS16800 | Genome accession | NZ_CP032852 |
| Coordinates | 3149670..3149843 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain GFR-12 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3144670..3154843
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C09_RS16785 (D9C09_16785) | gcvT | 3145470..3146558 (-) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9C09_RS16790 (D9C09_16790) | hepAA | 3146999..3148672 (+) | 1674 | WP_038829735.1 | SNF2-related protein | - |
| D9C09_RS16795 (D9C09_16795) | yqhG | 3148693..3149487 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C09_RS16800 (D9C09_16800) | sinI | 3149670..3149843 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C09_RS16805 (D9C09_16805) | sinR | 3149877..3150212 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D9C09_RS16810 (D9C09_16810) | tasA | 3150305..3151090 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C09_RS16815 (D9C09_16815) | sipW | 3151154..3151726 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C09_RS16820 (D9C09_16820) | tapA | 3151710..3152471 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C09_RS16825 (D9C09_16825) | yqzG | 3152743..3153069 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C09_RS16830 (D9C09_16830) | spoIITA | 3153111..3153290 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C09_RS16835 (D9C09_16835) | comGG | 3153361..3153735 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C09_RS16840 (D9C09_16840) | comGF | 3153736..3154119 (-) | 384 | WP_029317913.1 | ComG operon protein ComGF | Machinery gene |
| D9C09_RS16845 (D9C09_16845) | comGE | 3154145..3154492 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=278925 D9C09_RS16800 WP_003230187.1 3149670..3149843(+) (sinI) [Bacillus subtilis subsp. subtilis strain GFR-12]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=278925 D9C09_RS16800 WP_003230187.1 3149670..3149843(+) (sinI) [Bacillus subtilis subsp. subtilis strain GFR-12]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |