Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   C7A05_RS18090 Genome accession   NZ_CP027591
Coordinates   3080726..3081355 (-) Length   209 a.a.
NCBI ID   WP_032186268.1    Uniprot ID   -
Organism   Escherichia coli strain 2014C-3011     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3055797..3092529 3080726..3081355 within 0


Gene organization within MGE regions


Location: 3055797..3092529
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7A05_RS17915 - 3057403..3058176 (-) 774 WP_062881813.1 alpha/beta hydrolase -
  C7A05_RS17920 hokD 3058781..3058936 (+) 156 WP_000813263.1 type I toxin-antitoxin system toxin HokD -
  C7A05_RS17925 - 3059104..3059382 (+) 279 WP_074433979.1 hypothetical protein -
  C7A05_RS17930 - 3059384..3060433 (+) 1050 WP_001265133.1 DUF968 domain-containing protein -
  C7A05_RS17935 - 3060446..3060817 (+) 372 WP_001217436.1 RusA family crossover junction endodeoxyribonuclease -
  C7A05_RS17940 - 3060807..3061178 (+) 372 WP_000090265.1 antiterminator Q family protein -
  C7A05_RS17945 - 3061330..3062148 (+) 819 WP_000265267.1 CPBP family intramembrane glutamic endopeptidase -
  C7A05_RS17950 - 3062435..3062632 (+) 198 WP_000917737.1 hypothetical protein -
  C7A05_RS29795 - 3062767..3063192 (+) 426 WP_176465538.1 hypothetical protein -
  C7A05_RS17960 - 3063179..3063274 (-) 96 Protein_3165 Rha family transcriptional regulator -
  C7A05_RS17965 - 3063258..3063530 (-) 273 WP_000887453.1 YdaS family helix-turn-helix protein -
  C7A05_RS17970 - 3063639..3064040 (+) 402 WP_000986592.1 helix-turn-helix domain-containing protein -
  C7A05_RS17975 - 3064068..3064259 (+) 192 WP_000536233.1 hypothetical protein -
  C7A05_RS17980 - 3064259..3064546 (+) 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin -
  C7A05_RS17985 - 3064823..3064978 (+) 156 WP_000379575.1 DUF1391 family protein -
  C7A05_RS30600 ydfB 3064980..3065108 (+) 129 WP_000344963.1 protein YdfB -
  C7A05_RS17995 - 3065120..3065509 (+) 390 WP_032205089.1 hypothetical protein -
  C7A05_RS18000 - 3065696..3065881 (-) 186 WP_032205087.1 hypothetical protein -
  C7A05_RS18010 dicB 3066455..3066643 (+) 189 WP_000413705.1 cell division inhibition protein DicB -
  C7A05_RS18015 - 3066640..3066831 (+) 192 WP_001098307.1 DUF1482 family protein -
  C7A05_RS18020 - 3066925..3069360 (+) 2436 WP_106879261.1 exonuclease -
  C7A05_RS18025 - 3069428..3069670 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  C7A05_RS18030 - 3069648..3070667 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  C7A05_RS18035 yccA 3071075..3071734 (+) 660 WP_062882278.1 FtsH protease modulator YccA -
  C7A05_RS18040 tusE 3071825..3072154 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  C7A05_RS18045 yccX 3072151..3072429 (-) 279 WP_000048252.1 acylphosphatase -
  C7A05_RS18050 rlmI 3072524..3073714 (+) 1191 WP_062882280.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C7A05_RS18055 hspQ 3073772..3074089 (+) 318 WP_001295356.1 heat shock protein HspQ -
  C7A05_RS18060 yccU 3074134..3074547 (-) 414 WP_001343235.1 CoA-binding protein -
  C7A05_RS18065 yccT 3074720..3075382 (+) 663 WP_060616790.1 DUF2057 family protein -
  C7A05_RS18070 mgsA 3075478..3075936 (+) 459 WP_000424181.1 methylglyoxal synthase -
  C7A05_RS18075 helD 3075968..3078022 (-) 2055 WP_000420537.1 DNA helicase IV -
  C7A05_RS18080 yccF 3078145..3078591 (+) 447 WP_062882281.1 YccF domain-containing protein -
  C7A05_RS18085 yccS 3078601..3080763 (+) 2163 WP_074434046.1 YccS family putative transporter -
  C7A05_RS18090 sxy/tfoX 3080726..3081355 (-) 630 WP_032186268.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C7A05_RS18095 sulA 3081574..3082083 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  C7A05_RS18105 ompA 3082440..3083480 (+) 1041 WP_062882317.1 porin OmpA -
  C7A05_RS18110 matP 3083556..3084008 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C7A05_RS18115 ycbZ 3084194..3085954 (+) 1761 WP_062882282.1 Lon protease family protein -
  C7A05_RS18120 fabA 3086023..3086541 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C7A05_RS18125 rmf 3086611..3086778 (-) 168 WP_000828648.1 ribosome modulation factor -
  C7A05_RS18130 pqiC 3087034..3087597 (-) 564 WP_000759129.1 membrane integrity-associated transporter subunit PqiC -
  C7A05_RS18135 pqiB 3087594..3089234 (-) 1641 WP_000445561.1 intermembrane transport protein PqiB -
  C7A05_RS18140 pqiA 3089239..3090492 (-) 1254 WP_062882283.1 membrane integrity-associated transporter subunit PqiA -
  C7A05_RS18145 uup 3090622..3092529 (-) 1908 WP_062882284.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24177.04 Da        Isoelectric Point: 8.9883

>NTDB_id=278383 C7A05_RS18090 WP_032186268.1 3080726..3081355(-) (sxy/tfoX) [Escherichia coli strain 2014C-3011]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLWQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=278383 C7A05_RS18090 WP_032186268.1 3080726..3081355(-) (sxy/tfoX) [Escherichia coli strain 2014C-3011]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGTGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment