Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   C6999_RS12995 Genome accession   NZ_CP027582
Coordinates   2292047..2292676 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 2013C-4538     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2266852..2305179 2292047..2292676 within 0


Gene organization within MGE regions


Location: 2266852..2305179
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C6999_RS12790 - 2267073..2267345 (-) 273 WP_001342259.1 hypothetical protein -
  C6999_RS12795 - 2267481..2267738 (+) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  C6999_RS12800 - 2267744..2268043 (+) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  C6999_RS12805 - 2268248..2268592 (-) 345 WP_000206830.1 hypothetical protein -
  C6999_RS12810 - 2268589..2268954 (-) 366 WP_001229296.1 HNH endonuclease signature motif containing protein -
  C6999_RS12815 - 2268956..2269174 (-) 219 WP_000209152.1 DUF4014 family protein -
  C6999_RS12820 - 2269400..2269897 (-) 498 Protein_2382 ead/Ea22-like family protein -
  C6999_RS31690 - 2269894..2270070 (-) 177 WP_000753069.1 hypothetical protein -
  C6999_RS12825 - 2270063..2270245 (-) 183 WP_001224662.1 hypothetical protein -
  C6999_RS12830 - 2270279..2270491 (-) 213 WP_000935422.1 hypothetical protein -
  C6999_RS12835 - 2270542..2270898 (-) 357 WP_000403783.1 hypothetical protein -
  C6999_RS12840 - 2270876..2271337 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  C6999_RS12845 - 2271334..2271630 (-) 297 WP_001266133.1 DUF4406 domain-containing protein -
  C6999_RS12850 - 2271627..2272019 (-) 393 WP_001040234.1 DUF977 family protein -
  C6999_RS12855 - 2272035..2272760 (-) 726 WP_000450641.1 DUF1627 domain-containing protein -
  C6999_RS12860 - 2272794..2273255 (-) 462 WP_000139444.1 replication protein P -
  C6999_RS31400 - 2273248..2274258 (-) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  C6999_RS12870 - 2274345..2274782 (-) 438 WP_000693932.1 toxin YdaT family protein -
  C6999_RS12875 - 2274779..2275039 (-) 261 WP_001172789.1 YdaS family helix-turn-helix protein -
  C6999_RS12880 - 2275166..2275558 (+) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  C6999_RS12885 - 2275605..2275964 (-) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  C6999_RS12890 - 2275967..2276269 (-) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  C6999_RS31695 - 2276605..2276904 (+) 300 WP_012817750.1 hypothetical protein -
  C6999_RS12905 ydfC 2276976..2277194 (+) 219 WP_001171921.1 protein YdfC -
  C6999_RS12915 dicB 2277763..2277951 (+) 189 WP_000449175.1 cell division inhibition protein DicB -
  C6999_RS12920 - 2277948..2278136 (+) 189 WP_000199475.1 DUF1482 family protein -
  C6999_RS12925 - 2278231..2280681 (+) 2451 WP_000048499.1 exonuclease -
  C6999_RS12930 - 2280749..2280991 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  C6999_RS12935 - 2280969..2281988 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  C6999_RS12940 yccA 2282396..2283055 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  C6999_RS12945 tusE 2283146..2283475 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  C6999_RS12950 yccX 2283472..2283750 (-) 279 WP_000048244.1 acylphosphatase -
  C6999_RS12955 rlmI 2283845..2285035 (+) 1191 WP_000116304.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C6999_RS12960 hspQ 2285093..2285410 (+) 318 WP_001295356.1 heat shock protein HspQ -
  C6999_RS12965 yccU 2285455..2285868 (-) 414 WP_000665217.1 CoA-binding protein -
  C6999_RS12970 yccT 2286041..2286703 (+) 663 WP_000847791.1 DUF2057 family protein -
  C6999_RS12975 mgsA 2286799..2287257 (+) 459 WP_000424181.1 methylglyoxal synthase -
  C6999_RS12980 helD 2287289..2289343 (-) 2055 WP_001297106.1 DNA helicase IV -
  C6999_RS12985 yccF 2289466..2289912 (+) 447 WP_001261235.1 YccF domain-containing protein -
  C6999_RS12990 yccS 2289922..2292084 (+) 2163 WP_000875023.1 YccS family putative transporter -
  C6999_RS12995 sxy/tfoX 2292047..2292676 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C6999_RS13000 sulA 2292895..2293404 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  C6999_RS13010 ompA 2293761..2294801 (+) 1041 WP_000750416.1 porin OmpA -
  C6999_RS13015 matP 2294876..2295328 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C6999_RS13020 ycbZ 2295514..2297274 (+) 1761 WP_000156528.1 Lon protease family protein -
  C6999_RS13025 fabA 2297343..2297861 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C6999_RS13030 rmf 2297931..2298098 (-) 168 WP_000828648.1 ribosome modulation factor -
  C6999_RS13035 pqiC 2298354..2298917 (-) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  C6999_RS13040 pqiB 2298914..2300554 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  C6999_RS13045 pqiA 2300559..2301812 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C6999_RS13050 uup 2301942..2303849 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=278286 C6999_RS12995 WP_000839153.1 2292047..2292676(-) (sxy/tfoX) [Escherichia coli strain 2013C-4538]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=278286 C6999_RS12995 WP_000839153.1 2292047..2292676(-) (sxy/tfoX) [Escherichia coli strain 2013C-4538]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment