Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   A2F94_RS07345 Genome accession   NZ_CP027573
Coordinates   1285840..1286424 (-) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain 2013C-4081     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1263949..1302679 1285840..1286424 within 0


Gene organization within MGE regions


Location: 1263949..1302679
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A2F94_RS07185 - 1264011..1264274 (-) 264 WP_000224233.1 hypothetical protein -
  A2F94_RS07190 - 1264276..1264493 (-) 218 Protein_1334 DUF4014 family protein -
  A2F94_RS07195 - 1264526..1264738 (-) 213 WP_000935420.1 hypothetical protein -
  A2F94_RS07200 - 1264789..1265145 (-) 357 WP_000403777.1 hypothetical protein -
  A2F94_RS07205 - 1265123..1265584 (-) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  A2F94_RS07210 - 1265581..1265877 (-) 297 WP_001266135.1 DUF4406 domain-containing protein -
  A2F94_RS07215 - 1265874..1266296 (-) 423 WP_001151153.1 DUF977 family protein -
  A2F94_RS07220 - 1266337..1267407 (-) 1071 WP_001262389.1 hypothetical protein -
  A2F94_RS07225 - 1267479..1267904 (-) 426 WP_000693949.1 toxin YdaT family protein -
  A2F94_RS07230 - 1267901..1268116 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  A2F94_RS07235 - 1268166..1268882 (+) 717 WP_000103686.1 LexA family transcriptional regulator -
  A2F94_RS07245 - 1269155..1269307 (+) 153 WP_000379580.1 DUF1391 family protein -
  A2F94_RS07250 - 1269319..1269693 (+) 375 WP_000394557.1 hypothetical protein -
  A2F94_RS07260 dicB 1270225..1270413 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  A2F94_RS07265 - 1270410..1270601 (+) 192 WP_001090200.1 DUF1482 family protein -
  A2F94_RS07270 - 1270694..1272115 (+) 1422 Protein_1348 exonuclease -
  A2F94_RS07275 - 1272170..1273383 (+) 1214 WP_171877072.1 IS3-like element IS1203 family transposase -
  A2F94_RS07280 - 1273426..1274478 (+) 1053 Protein_1350 3'-5' exoribonuclease domain-containing protein -
  A2F94_RS30665 - 1274546..1274788 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  A2F94_RS07285 - 1274766..1275781 (+) 1016 Protein_1352 tyrosine-type recombinase/integrase -
  A2F94_RS07290 yccA 1276189..1276848 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  A2F94_RS07295 tusE 1276939..1277268 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  A2F94_RS07300 yccX 1277265..1277543 (-) 279 WP_000048244.1 acylphosphatase -
  A2F94_RS07305 rlmI 1277638..1278828 (+) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  A2F94_RS07310 hspQ 1278886..1279203 (+) 318 WP_001295356.1 heat shock protein HspQ -
  A2F94_RS07315 yccU 1279248..1279661 (-) 414 WP_000665217.1 CoA-binding protein -
  A2F94_RS07320 yccT 1279834..1280496 (+) 663 WP_000847791.1 DUF2057 family protein -
  A2F94_RS07325 mgsA 1280592..1281050 (+) 459 WP_000424181.1 methylglyoxal synthase -
  A2F94_RS07330 helD 1281082..1283136 (-) 2055 WP_001297106.1 DNA helicase IV -
  A2F94_RS07335 yccF 1283259..1283705 (+) 447 WP_001261235.1 YccF domain-containing protein -
  A2F94_RS07340 yccS 1283715..1285877 (+) 2163 WP_000875023.1 YccS family putative transporter -
  A2F94_RS07345 sxy/tfoX 1285840..1286424 (-) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  A2F94_RS07350 sulA 1286688..1287197 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  A2F94_RS07360 ompA 1287554..1288594 (+) 1041 WP_000750416.1 porin OmpA -
  A2F94_RS07365 matP 1288670..1289122 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  A2F94_RS07370 ycbZ 1289308..1291068 (+) 1761 WP_000156528.1 Lon protease family protein -
  A2F94_RS07375 fabA 1291137..1291655 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  A2F94_RS07380 rmf 1291725..1291892 (-) 168 WP_000828648.1 ribosome modulation factor -
  A2F94_RS07385 pqiC 1292148..1292711 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  A2F94_RS07390 pqiB 1292708..1294348 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  A2F94_RS07395 pqiA 1294353..1295606 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  A2F94_RS07400 uup 1295736..1297643 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  A2F94_RS07405 rlmKL 1297655..1299763 (-) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  A2F94_RS07410 ycbX 1300007..1301116 (+) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  A2F94_RS07415 zapC 1301113..1301655 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=278217 A2F94_RS07345 WP_077825616.1 1285840..1286424(-) (sxy/tfoX) [Escherichia coli strain 2013C-4081]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=278217 A2F94_RS07345 WP_077825616.1 1285840..1286424(-) (sxy/tfoX) [Escherichia coli strain 2013C-4081]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment