Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   C6953_RS12840 Genome accession   NZ_CP027552
Coordinates   2499795..2500424 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 2015C-4498     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2483585..2520995 2499795..2500424 within 0


Gene organization within MGE regions


Location: 2483585..2520995
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C6953_RS12770 zapC 2484609..2485151 (+) 543 WP_001295353.1 cell division protein ZapC -
  C6953_RS12775 ycbX 2485148..2486257 (-) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  C6953_RS12780 rlmKL 2486501..2488609 (+) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  C6953_RS12785 uup 2488621..2490528 (+) 1908 WP_044806219.1 ABC transporter ATP-binding protein -
  C6953_RS12790 pqiA 2490658..2491911 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C6953_RS12795 pqiB 2491916..2493556 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  C6953_RS12800 pqiC 2493553..2494116 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  C6953_RS12805 rmf 2494372..2494539 (+) 168 WP_000828648.1 ribosome modulation factor -
  C6953_RS12810 fabA 2494609..2495127 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C6953_RS12815 ycbZ 2495196..2496956 (-) 1761 WP_000156528.1 Lon protease family protein -
  C6953_RS12820 matP 2497142..2497594 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C6953_RS12825 ompA 2497670..2498710 (-) 1041 WP_001400178.1 porin OmpA -
  C6953_RS12835 sulA 2499067..2499576 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  C6953_RS12840 sxy/tfoX 2499795..2500424 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C6953_RS12845 yccS 2500387..2502549 (-) 2163 WP_000875023.1 YccS family putative transporter -
  C6953_RS12850 yccF 2502559..2503005 (-) 447 WP_001261235.1 YccF domain-containing protein -
  C6953_RS12855 helD 2503128..2505182 (+) 2055 WP_044806220.1 DNA helicase IV -
  C6953_RS12860 mgsA 2505214..2505672 (-) 459 WP_000424181.1 methylglyoxal synthase -
  C6953_RS12865 yccT 2505768..2506430 (-) 663 WP_000847791.1 DUF2057 family protein -
  C6953_RS12870 yccU 2506603..2507016 (+) 414 WP_000665217.1 CoA-binding protein -
  C6953_RS12875 hspQ 2507061..2507378 (-) 318 WP_001295356.1 heat shock protein HspQ -
  C6953_RS12880 rlmI 2507436..2508626 (-) 1191 WP_106884037.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C6953_RS12885 yccX 2508721..2508999 (+) 279 WP_000048244.1 acylphosphatase -
  C6953_RS12890 tusE 2508996..2509325 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  C6953_RS12895 yccA 2509416..2510075 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  C6953_RS12900 - 2510483..2511502 (-) 1020 WP_001299701.1 tyrosine-type recombinase/integrase -
  C6953_RS12905 - 2511480..2511722 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  C6953_RS12910 - 2511790..2514261 (-) 2472 WP_044806223.1 exonuclease -
  C6953_RS12915 - 2514354..2514545 (-) 192 WP_001090200.1 DUF1482 family protein -
  C6953_RS12920 dicB 2514542..2514730 (-) 189 WP_000449192.1 cell division inhibition protein DicB -
  C6953_RS12925 - 2515263..2515637 (-) 375 WP_000394557.1 hypothetical protein -
  C6953_RS12930 ydfA 2515649..2515801 (-) 153 WP_000379580.1 DUF1391 family protein -
  C6953_RS12940 - 2516074..2516790 (-) 717 WP_000103686.1 S24 family peptidase -
  C6953_RS12945 - 2516840..2517055 (+) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  C6953_RS12950 - 2517052..2517477 (+) 426 WP_000693949.1 toxin YdaT family protein -
  C6953_RS12955 - 2517549..2518607 (+) 1059 WP_106884039.1 phage replisome organizer -
  C6953_RS12960 - 2518648..2519070 (+) 423 WP_106884040.1 DUF977 family protein -
  C6953_RS12965 - 2519067..2519363 (+) 297 WP_001266134.1 DUF4406 domain-containing protein -
  C6953_RS12970 - 2519360..2519821 (+) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  C6953_RS12975 - 2519799..2520155 (+) 357 WP_000403777.1 hypothetical protein -
  C6953_RS12980 - 2520206..2520418 (+) 213 WP_000935420.1 hypothetical protein -
  C6953_RS12985 - 2520451..2520668 (+) 218 Protein_2374 DUF4014 family protein -
  C6953_RS12990 - 2520670..2520933 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=278080 C6953_RS12840 WP_000839153.1 2499795..2500424(+) (sxy/tfoX) [Escherichia coli strain 2015C-4498]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=278080 C6953_RS12840 WP_000839153.1 2499795..2500424(+) (sxy/tfoX) [Escherichia coli strain 2015C-4498]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment