Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   D8S77_RS00680 Genome accession   NZ_CP032700
Coordinates   104615..104899 (+) Length   94 a.a.
NCBI ID   WP_032465969.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain TSPY556     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99615..109899
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D8S77_RS00655 (D8S77_00655) - 101561..101926 (+) 366 WP_002986560.1 DUF1033 family protein -
  D8S77_RS00660 (D8S77_00660) comGA 102019..102957 (+) 939 WP_063812149.1 competence type IV pilus ATPase ComGA Machinery gene
  D8S77_RS00665 (D8S77_00665) comGB 102893..103927 (+) 1035 WP_233436572.1 competence type IV pilus assembly protein ComGB Machinery gene
  D8S77_RS00670 (D8S77_00670) comGC 103929..104255 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  D8S77_RS00675 (D8S77_00675) comGD 104230..104658 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  D8S77_RS00680 (D8S77_00680) comGE 104615..104899 (+) 285 WP_032465969.1 competence type IV pilus minor pilin ComGE Machinery gene
  D8S77_RS00685 (D8S77_00685) comGF 104892..105326 (+) 435 WP_129321637.1 competence type IV pilus minor pilin ComGF Machinery gene
  D8S77_RS00690 (D8S77_00690) comGG 105310..105636 (+) 327 WP_129321638.1 competence type IV pilus minor pilin ComGG -
  D8S77_RS00695 (D8S77_00695) comGH 105734..106687 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  D8S77_RS00700 (D8S77_00700) - 106746..107942 (+) 1197 WP_010921803.1 acetate kinase -
  D8S77_RS00705 (D8S77_00705) - 108129..108437 (+) 309 WP_111677000.1 hypothetical protein -
  D8S77_RS00710 (D8S77_00710) proC 108520..109290 (-) 771 WP_129321639.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10660.57 Da        Isoelectric Point: 8.9043

>NTDB_id=277688 D8S77_RS00680 WP_032465969.1 104615..104899(+) (comGE) [Streptococcus pyogenes strain TSPY556]
MGIIKKQVKAYIALESMIATGTLFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=277688 D8S77_RS00680 WP_032465969.1 104615..104899(+) (comGE) [Streptococcus pyogenes strain TSPY556]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCACCCTCTTTAGTATTGT
CATTCTCGTCTTGAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383