Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   AAF93_RS13010 Genome accession   NZ_CP027472
Coordinates   2297568..2298197 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 2014C-3050     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2272373..2310700 2297568..2298197 within 0


Gene organization within MGE regions


Location: 2272373..2310700
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAF93_RS12805 - 2272594..2272866 (-) 273 WP_001342259.1 hypothetical protein -
  AAF93_RS12810 - 2273002..2273259 (+) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  AAF93_RS12815 - 2273265..2273564 (+) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  AAF93_RS12820 - 2273769..2274113 (-) 345 WP_000206830.1 hypothetical protein -
  AAF93_RS12825 - 2274110..2274475 (-) 366 WP_001229296.1 HNH endonuclease -
  AAF93_RS12830 - 2274477..2274695 (-) 219 WP_000209152.1 DUF4014 family protein -
  AAF93_RS12835 - 2274906..2275418 (-) 513 Protein_2378 ead/Ea22-like family protein -
  AAF93_RS31720 - 2275415..2275591 (-) 177 WP_000753069.1 hypothetical protein -
  AAF93_RS12840 - 2275584..2275766 (-) 183 WP_001224662.1 hypothetical protein -
  AAF93_RS12845 - 2275800..2276012 (-) 213 WP_000935422.1 hypothetical protein -
  AAF93_RS12850 - 2276063..2276419 (-) 357 WP_000403783.1 hypothetical protein -
  AAF93_RS12855 - 2276397..2276858 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  AAF93_RS12860 - 2276855..2277151 (-) 297 WP_001266133.1 DUF4406 domain-containing protein -
  AAF93_RS12865 - 2277148..2277540 (-) 393 WP_001040234.1 DUF977 family protein -
  AAF93_RS12870 - 2277556..2278281 (-) 726 WP_000450641.1 DUF1627 domain-containing protein -
  AAF93_RS12875 - 2278315..2278776 (-) 462 WP_000139444.1 replication protein P -
  AAF93_RS31400 - 2278769..2279779 (-) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  AAF93_RS12885 - 2279866..2280303 (-) 438 WP_000693932.1 toxin YdaT family protein -
  AAF93_RS12890 - 2280300..2280560 (-) 261 WP_001172789.1 YdaS family helix-turn-helix protein -
  AAF93_RS12895 - 2280687..2281079 (+) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  AAF93_RS12900 - 2281126..2281485 (-) 360 WP_001022415.1 type II toxin-antitoxin system HigA family antitoxin -
  AAF93_RS12905 - 2281488..2281790 (-) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  AAF93_RS31725 - 2282126..2282425 (+) 300 WP_012817750.1 hypothetical protein -
  AAF93_RS12920 ydfC 2282497..2282715 (+) 219 WP_001171921.1 protein YdfC -
  AAF93_RS12930 dicB 2283284..2283472 (+) 189 WP_000449175.1 cell division inhibition protein DicB -
  AAF93_RS12935 - 2283469..2283657 (+) 189 WP_000199475.1 DUF1482 family protein -
  AAF93_RS12940 - 2283752..2286202 (+) 2451 WP_000048499.1 exonuclease -
  AAF93_RS12945 - 2286270..2286512 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  AAF93_RS12950 - 2286490..2287509 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  AAF93_RS12955 yccA 2287917..2288576 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  AAF93_RS12960 tusE 2288667..2288996 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AAF93_RS12965 yccX 2288993..2289271 (-) 279 WP_000048244.1 acylphosphatase -
  AAF93_RS12970 rlmI 2289366..2290556 (+) 1191 WP_000116304.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AAF93_RS12975 hspQ 2290614..2290931 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AAF93_RS12980 yccU 2290976..2291389 (-) 414 WP_000665217.1 CoA-binding protein -
  AAF93_RS12985 yccT 2291562..2292224 (+) 663 WP_000847791.1 DUF2057 family protein -
  AAF93_RS12990 mgsA 2292320..2292778 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AAF93_RS12995 helD 2292810..2294864 (-) 2055 WP_001297106.1 DNA helicase IV -
  AAF93_RS13000 yccF 2294987..2295433 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AAF93_RS13005 yccS 2295443..2297605 (+) 2163 WP_000875023.1 YccS family putative transporter -
  AAF93_RS13010 sxy/tfoX 2297568..2298197 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AAF93_RS13015 sulA 2298416..2298925 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AAF93_RS13025 ompA 2299282..2300322 (+) 1041 WP_000750416.1 porin OmpA -
  AAF93_RS13030 matP 2300397..2300849 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  AAF93_RS13035 ycbZ 2301035..2302795 (+) 1761 WP_000156528.1 Lon protease family protein -
  AAF93_RS13040 fabA 2302864..2303382 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AAF93_RS13045 rmf 2303452..2303619 (-) 168 WP_000828648.1 ribosome modulation factor -
  AAF93_RS13050 pqiC 2303875..2304438 (-) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  AAF93_RS13055 pqiB 2304435..2306075 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AAF93_RS13060 pqiA 2306080..2307333 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AAF93_RS13065 uup 2307463..2309370 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=277447 AAF93_RS13010 WP_000839153.1 2297568..2298197(-) (sxy/tfoX) [Escherichia coli strain 2014C-3050]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=277447 AAF93_RS13010 WP_000839153.1 2297568..2298197(-) (sxy/tfoX) [Escherichia coli strain 2014C-3050]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment