Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   C6W74_RS12640 Genome accession   NZ_CP027454
Coordinates   2485198..2485827 (+) Length   209 a.a.
NCBI ID   WP_000841914.1    Uniprot ID   A0AAP9MNK0
Organism   Escherichia coli strain 2014C-4423     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2465424..2500893 2485198..2485827 within 0


Gene organization within MGE regions


Location: 2465424..2500893
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C6W74_RS12545 elfG 2465858..2466928 (+) 1071 WP_106901531.1 fimbrial protein -
  C6W74_RS12550 ycbU 2466940..2467482 (+) 543 WP_000730616.1 fimbrial protein -
  C6W74_RS12555 ycbV 2467490..2468005 (+) 516 WP_000919489.1 fimbrial protein -
  C6W74_RS12560 ycbF 2467971..2468708 (+) 738 WP_001111474.1 fimbrial chaperone -
  C6W74_RS12565 pyrD 2468819..2469829 (+) 1011 WP_001370288.1 quinone-dependent dihydroorotate dehydrogenase -
  C6W74_RS12570 zapC 2470003..2470545 (+) 543 WP_001338438.1 cell division protein ZapC -
  C6W74_RS12575 ycbX 2470542..2471651 (-) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  C6W74_RS12580 rlmKL 2471894..2474002 (+) 2109 WP_001086532.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  C6W74_RS12585 uup 2474014..2475921 (+) 1908 WP_000053123.1 ABC transporter ATP-binding protein -
  C6W74_RS12590 pqiA 2476051..2477304 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C6W74_RS12595 pqiB 2477309..2478949 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  C6W74_RS12600 pqiC 2478946..2479509 (+) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  C6W74_RS12605 rmf 2479764..2479931 (+) 168 WP_000828648.1 ribosome modulation factor -
  C6W74_RS12610 fabA 2480001..2480519 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C6W74_RS12615 ycbZ 2480588..2482348 (-) 1761 WP_000156526.1 Lon protease family protein -
  C6W74_RS12620 matP 2482534..2482986 (+) 453 WP_000877158.1 macrodomain Ter protein MatP -
  C6W74_RS12625 ompA 2483061..2484113 (-) 1053 WP_000750419.1 porin OmpA -
  C6W74_RS12635 sulA 2484470..2484979 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  C6W74_RS12640 sxy/tfoX 2485198..2485827 (+) 630 WP_000841914.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C6W74_RS12645 yccS 2485790..2487952 (-) 2163 WP_000875061.1 YccS family putative transporter -
  C6W74_RS12650 yccF 2487962..2488408 (-) 447 WP_001261235.1 YccF domain-containing protein -
  C6W74_RS12655 helD 2488531..2490585 (+) 2055 WP_001295354.1 DNA helicase IV -
  C6W74_RS12660 mgsA 2490617..2491075 (-) 459 WP_000424181.1 methylglyoxal synthase -
  C6W74_RS12665 yccT 2491171..2491833 (-) 663 WP_000847791.1 DUF2057 family protein -
  C6W74_RS12670 yccU 2492006..2492419 (+) 414 WP_000665217.1 CoA-binding protein -
  C6W74_RS12675 hspQ 2492464..2492781 (-) 318 WP_001295356.1 heat shock protein HspQ -
  C6W74_RS12680 rlmI 2492839..2494029 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C6W74_RS12685 yccX 2494124..2494402 (+) 279 WP_000048233.1 acylphosphatase -
  C6W74_RS12690 tusE 2494399..2494728 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  C6W74_RS12695 yccA 2494819..2495478 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  C6W74_RS12700 - 2495886..2496905 (-) 1020 WP_001370339.1 tyrosine-type recombinase/integrase -
  C6W74_RS12705 - 2496883..2497125 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  C6W74_RS12710 - 2497193..2498602 (-) 1410 Protein_2328 3'-5' exoribonuclease -
  C6W74_RS12715 - 2498635..2500191 (-) 1557 WP_001066419.1 IS66 family transposase -
  C6W74_RS12720 tnpB 2500211..2500558 (-) 348 WP_000631725.1 IS66 family insertion sequence element accessory protein TnpB -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24130.97 Da        Isoelectric Point: 9.2180

>NTDB_id=277341 C6W74_RS12640 WP_000841914.1 2485198..2485827(+) (sxy/tfoX) [Escherichia coli strain 2014C-4423]
MKSPSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=277341 C6W74_RS12640 WP_000841914.1 2485198..2485827(+) (sxy/tfoX) [Escherichia coli strain 2014C-4423]
ATGAAAAGCCCCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment