Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   CFK78_RS08500 Genome accession   NZ_CP032633
Coordinates   1694523..1694822 (-) Length   99 a.a.
NCBI ID   WP_025016383.1    Uniprot ID   -
Organism   Latilactobacillus sakei strain ZFM220     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1689523..1699822
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFK78_RS08465 (CFK78_08465) - 1690154..1690612 (-) 459 WP_035145008.1 hypothetical protein -
  CFK78_RS08470 (CFK78_08470) - 1690667..1691863 (-) 1197 WP_011374993.1 acetate/propionate family kinase -
  CFK78_RS08475 (CFK78_08475) - 1691885..1692895 (-) 1011 WP_016265372.1 class I SAM-dependent methyltransferase -
  CFK78_RS08480 (CFK78_08480) - 1693019..1693357 (-) 339 WP_035145011.1 hypothetical protein -
  CFK78_RS08485 (CFK78_08485) comGF 1693320..1693832 (-) 513 WP_035145013.1 competence type IV pilus minor pilin ComGF Machinery gene
  CFK78_RS08490 (CFK78_08490) comGE 1693807..1694112 (-) 306 WP_016265375.1 hypothetical protein Machinery gene
  CFK78_RS08495 (CFK78_08495) comGD 1694099..1694503 (-) 405 WP_235596237.1 hypothetical protein Machinery gene
  CFK78_RS08500 (CFK78_08500) comGC 1694523..1694822 (-) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  CFK78_RS08505 (CFK78_08505) comGB 1694819..1695826 (-) 1008 WP_061827023.1 type II secretion system F family protein Machinery gene
  CFK78_RS08510 (CFK78_08510) comGA 1695819..1696709 (-) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  CFK78_RS08515 (CFK78_08515) - 1696826..1697557 (-) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  CFK78_RS08520 (CFK78_08520) - 1697648..1698148 (-) 501 WP_016265379.1 VanZ family protein -
  CFK78_RS08525 (CFK78_08525) - 1698245..1698619 (+) 375 WP_011375004.1 hypothetical protein -
  CFK78_RS08535 (CFK78_08535) - 1698806..1699420 (-) 615 WP_016265380.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11067.03 Da        Isoelectric Point: 10.1321

>NTDB_id=276973 CFK78_RS08500 WP_025016383.1 1694523..1694822(-) (comGC) [Latilactobacillus sakei strain ZFM220]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKKTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKEKGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=276973 CFK78_RS08500 WP_025016383.1 1694523..1694822(-) (comGC) [Latilactobacillus sakei strain ZFM220]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCAATTGTGGCGTTGTTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAAAACCGATCAAGCTTTAGTGACGACTTTACAAACGCAAG
TTGAATTGGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGATGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGATAGCGGCACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

89.899

100

0.899