Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   AYN27_RS17835 Genome accession   NZ_CP027380
Coordinates   3192283..3192867 (-) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain 2013C-3250     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3171704..3209122 3192283..3192867 within 0


Gene organization within MGE regions


Location: 3171704..3209122
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AYN27_RS17685 - 3171766..3172029 (-) 264 WP_000224233.1 hypothetical protein -
  AYN27_RS17690 - 3172031..3172248 (-) 218 Protein_3298 DUF4014 family protein -
  AYN27_RS17695 - 3172281..3172493 (-) 213 WP_000935420.1 hypothetical protein -
  AYN27_RS17700 - 3172544..3172900 (-) 357 WP_000403777.1 hypothetical protein -
  AYN27_RS17705 - 3172878..3173339 (-) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  AYN27_RS17710 - 3173336..3173632 (-) 297 WP_001266135.1 DUF4406 domain-containing protein -
  AYN27_RS17715 - 3173629..3174051 (-) 423 WP_001151153.1 DUF977 family protein -
  AYN27_RS17720 - 3174092..3175162 (-) 1071 WP_001262389.1 hypothetical protein -
  AYN27_RS17725 - 3175234..3175659 (-) 426 WP_000693949.1 toxin YdaT family protein -
  AYN27_RS17730 - 3175656..3175871 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  AYN27_RS17735 - 3175921..3176637 (+) 717 WP_000103686.1 LexA family transcriptional regulator -
  AYN27_RS17745 - 3176910..3177062 (+) 153 WP_000379580.1 DUF1391 family protein -
  AYN27_RS17750 - 3177074..3177448 (+) 375 WP_000394557.1 hypothetical protein -
  AYN27_RS17760 dicB 3177980..3178168 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  AYN27_RS17765 - 3178165..3178356 (+) 192 WP_001090200.1 DUF1482 family protein -
  AYN27_RS17770 - 3178449..3180921 (+) 2473 Protein_3312 3'-5' exoribonuclease domain-containing protein -
  AYN27_RS31120 - 3180989..3181231 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  AYN27_RS17775 - 3181209..3182224 (+) 1016 Protein_3314 tyrosine-type recombinase/integrase -
  AYN27_RS17780 yccA 3182632..3183291 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  AYN27_RS17785 tusE 3183382..3183711 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AYN27_RS17790 yccX 3183708..3183986 (-) 279 WP_000048244.1 acylphosphatase -
  AYN27_RS17795 rlmI 3184081..3185271 (+) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AYN27_RS17800 hspQ 3185329..3185646 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AYN27_RS17805 yccU 3185691..3186104 (-) 414 WP_000665217.1 CoA-binding protein -
  AYN27_RS17810 yccT 3186277..3186939 (+) 663 WP_000847791.1 DUF2057 family protein -
  AYN27_RS17815 mgsA 3187035..3187493 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AYN27_RS17820 helD 3187525..3189579 (-) 2055 WP_001297106.1 DNA helicase IV -
  AYN27_RS17825 yccF 3189702..3190148 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AYN27_RS17830 yccS 3190158..3192320 (+) 2163 WP_000875023.1 YccS family putative transporter -
  AYN27_RS17835 sxy/tfoX 3192283..3192867 (-) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AYN27_RS17840 sulA 3193131..3193640 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AYN27_RS17850 ompA 3193997..3195037 (+) 1041 WP_000750416.1 porin OmpA -
  AYN27_RS17855 matP 3195113..3195565 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  AYN27_RS17860 ycbZ 3195751..3197511 (+) 1761 WP_000156528.1 Lon protease family protein -
  AYN27_RS17865 fabA 3197580..3198098 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AYN27_RS17870 rmf 3198168..3198335 (-) 168 WP_000828648.1 ribosome modulation factor -
  AYN27_RS17875 pqiC 3198591..3199154 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  AYN27_RS17880 pqiB 3199151..3200791 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AYN27_RS17885 pqiA 3200796..3202049 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AYN27_RS17890 uup 3202179..3204086 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  AYN27_RS17895 rlmKL 3204098..3206206 (-) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  AYN27_RS17900 ycbX 3206450..3207559 (+) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  AYN27_RS17905 zapC 3207556..3208098 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=276726 AYN27_RS17835 WP_077825616.1 3192283..3192867(-) (sxy/tfoX) [Escherichia coli strain 2013C-3250]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=276726 AYN27_RS17835 WP_077825616.1 3192283..3192867(-) (sxy/tfoX) [Escherichia coli strain 2013C-3250]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment