Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   C6P55_RS10680 Genome accession   NZ_CP027355
Coordinates   1872172..1872801 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 2013C-4991     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1855062..1893524 1872172..1872801 within 0


Gene organization within MGE regions


Location: 1855062..1893524
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C6P55_RS10565 - 1855349..1855630 (-) 282 WP_000391950.1 YdaS family helix-turn-helix protein -
  C6P55_RS10570 - 1855731..1856150 (+) 420 WP_000362153.1 hypothetical protein -
  C6P55_RS10575 - 1856416..1856571 (+) 156 WP_000379589.1 DUF1391 family protein -
  C6P55_RS31920 ydfB 1856573..1856701 (+) 129 WP_000344935.1 protein YdfB -
  C6P55_RS10585 ydfC 1856731..1856949 (+) 219 WP_001171930.1 protein YdfC -
  C6P55_RS10590 - 1856972..1857346 (+) 375 WP_000394532.1 hypothetical protein -
  C6P55_RS10600 dicB 1857866..1858054 (+) 189 WP_000449175.1 cell division inhibition protein DicB -
  C6P55_RS10605 - 1858051..1858239 (+) 189 WP_000199473.1 DUF1482 family protein -
  C6P55_RS10610 - 1858335..1860806 (+) 2472 WP_052924991.1 exonuclease -
  C6P55_RS10615 - 1860874..1861116 (+) 243 WP_032256979.1 DUF4224 domain-containing protein -
  C6P55_RS10620 - 1861094..1862113 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  C6P55_RS10625 yccA 1862521..1863180 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  C6P55_RS10630 tusE 1863271..1863600 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  C6P55_RS10635 yccX 1863597..1863875 (-) 279 WP_000048252.1 acylphosphatase -
  C6P55_RS10640 rlmI 1863970..1865160 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C6P55_RS10645 hspQ 1865218..1865535 (+) 318 WP_001295356.1 heat shock protein HspQ -
  C6P55_RS10650 yccU 1865580..1865993 (-) 414 WP_001301418.1 CoA-binding protein -
  C6P55_RS10655 yccT 1866166..1866828 (+) 663 WP_000847791.1 DUF2057 family protein -
  C6P55_RS10660 mgsA 1866924..1867382 (+) 459 WP_000424181.1 methylglyoxal synthase -
  C6P55_RS10665 helD 1867414..1869468 (-) 2055 WP_000420536.1 DNA helicase IV -
  C6P55_RS10670 yccF 1869591..1870037 (+) 447 WP_001261235.1 YccF domain-containing protein -
  C6P55_RS10675 yccS 1870047..1872209 (+) 2163 WP_000875061.1 YccS family putative transporter -
  C6P55_RS10680 sxy/tfoX 1872172..1872801 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C6P55_RS10685 sulA 1873020..1873529 (+) 510 WP_000288706.1 SOS-induced cell division inhibitor SulA -
  C6P55_RS10695 ompA 1873886..1874938 (+) 1053 WP_001361736.1 porin OmpA -
  C6P55_RS10700 matP 1875014..1875466 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C6P55_RS10705 ycbZ 1875652..1877412 (+) 1761 WP_000156518.1 Lon protease family protein -
  C6P55_RS10710 fabA 1877481..1877999 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C6P55_RS10715 rmf 1878069..1878236 (-) 168 WP_000828648.1 ribosome modulation factor -
  C6P55_RS10720 pqiC 1878492..1879055 (-) 564 WP_000759118.1 membrane integrity-associated transporter subunit PqiC -
  C6P55_RS10725 pqiB 1879052..1880692 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  C6P55_RS10730 pqiA 1880697..1881950 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C6P55_RS10735 uup 1882080..1883987 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  C6P55_RS10740 rlmKL 1883998..1886106 (-) 2109 WP_001086517.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  C6P55_RS10745 ycbX 1886350..1887459 (+) 1110 WP_000224273.1 6-N-hydroxylaminopurine resistance protein YcbX -
  C6P55_RS10750 zapC 1887456..1887998 (-) 543 WP_001295353.1 cell division protein ZapC -
  C6P55_RS10755 pyrD 1888172..1889182 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  C6P55_RS10760 ycbF 1889293..1890030 (-) 738 WP_001111463.1 fimbrial chaperone -
  C6P55_RS10765 ycbV 1889996..1890511 (-) 516 WP_000919497.1 fimbrial protein -
  C6P55_RS10770 ycbU 1890519..1891061 (-) 543 WP_000730614.1 fimbrial protein -
  C6P55_RS10775 elfG 1891073..1892143 (-) 1071 WP_001165668.1 fimbrial protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=276544 C6P55_RS10680 WP_000839153.1 1872172..1872801(-) (sxy/tfoX) [Escherichia coli strain 2013C-4991]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=276544 C6P55_RS10680 WP_000839153.1 1872172..1872801(-) (sxy/tfoX) [Escherichia coli strain 2013C-4991]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGATGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment