Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   ND05_RS12265 Genome accession   NZ_CP027351
Coordinates   2325166..2325795 (+) Length   209 a.a.
NCBI ID   WP_000841914.1    Uniprot ID   A0AAP9MNK0
Organism   Escherichia coli strain 2014C-3655     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2308947..2346554 2325166..2325795 within 0


Gene organization within MGE regions


Location: 2308947..2346554
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ND05_RS12195 zapC 2309971..2310513 (+) 543 WP_001338438.1 cell division protein ZapC -
  ND05_RS12200 ycbX 2310510..2311619 (-) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  ND05_RS12205 rlmKL 2311862..2313970 (+) 2109 WP_001086532.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ND05_RS12210 uup 2313982..2315889 (+) 1908 WP_000053123.1 ABC transporter ATP-binding protein -
  ND05_RS12215 pqiA 2316019..2317272 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  ND05_RS12220 pqiB 2317277..2318917 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  ND05_RS12225 pqiC 2318914..2319477 (+) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  ND05_RS12230 rmf 2319732..2319899 (+) 168 WP_000828648.1 ribosome modulation factor -
  ND05_RS12235 fabA 2319969..2320487 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ND05_RS12240 ycbZ 2320556..2322316 (-) 1761 WP_000156526.1 Lon protease family protein -
  ND05_RS12245 matP 2322502..2322954 (+) 453 WP_000877158.1 macrodomain Ter protein MatP -
  ND05_RS12250 ompA 2323029..2324081 (-) 1053 WP_000750419.1 porin OmpA -
  ND05_RS12260 sulA 2324438..2324947 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  ND05_RS12265 sxy/tfoX 2325166..2325795 (+) 630 WP_000841914.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  ND05_RS12270 yccS 2325758..2327920 (-) 2163 WP_000875061.1 YccS family putative transporter -
  ND05_RS12275 yccF 2327930..2328376 (-) 447 WP_001261235.1 YccF domain-containing protein -
  ND05_RS12280 helD 2328499..2330553 (+) 2055 WP_001295354.1 DNA helicase IV -
  ND05_RS12285 mgsA 2330585..2331043 (-) 459 WP_000424181.1 methylglyoxal synthase -
  ND05_RS12290 yccT 2331139..2331801 (-) 663 WP_000847791.1 DUF2057 family protein -
  ND05_RS12295 yccU 2331974..2332387 (+) 414 WP_000665217.1 CoA-binding protein -
  ND05_RS12300 hspQ 2332432..2332749 (-) 318 WP_001295356.1 heat shock protein HspQ -
  ND05_RS12305 rlmI 2332807..2333997 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  ND05_RS12310 yccX 2334092..2334370 (+) 279 WP_000048233.1 acylphosphatase -
  ND05_RS12315 tusE 2334367..2334696 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  ND05_RS12320 yccA 2334787..2335446 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  ND05_RS12325 - 2335854..2336873 (-) 1020 WP_001370339.1 tyrosine-type recombinase/integrase -
  ND05_RS12330 - 2336851..2337093 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  ND05_RS12335 - 2337161..2339596 (-) 2436 WP_032212635.1 exonuclease -
  ND05_RS12340 - 2339677..2339880 (-) 204 WP_001098749.1 DUF1482 family protein -
  ND05_RS12345 dicB 2339883..2340065 (-) 183 WP_000449182.1 cell division inhibition protein DicB -
  ND05_RS12355 - 2340811..2341200 (-) 390 WP_000394568.1 hypothetical protein -
  ND05_RS12360 - 2341212..2341364 (-) 153 WP_000379585.1 DUF1391 family protein -
  ND05_RS12365 racR 2341680..2342156 (-) 477 WP_000948459.1 DNA-binding transcriptional repressor RacR -
  ND05_RS12370 ydaS 2342280..2342576 (+) 297 WP_000712069.1 toxin YdaS -
  ND05_RS12375 - 2342599..2343024 (+) 426 WP_000693884.1 toxin YdaT family protein -
  ND05_RS12380 - 2343096..2344166 (+) 1071 WP_001262384.1 hypothetical protein -
  ND05_RS12385 - 2344207..2344629 (+) 423 WP_001151153.1 DUF977 family protein -
  ND05_RS12390 - 2344626..2344922 (+) 297 WP_001266134.1 DUF4406 domain-containing protein -
  ND05_RS12395 - 2344919..2345380 (+) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  ND05_RS12400 - 2345358..2345714 (+) 357 WP_000403777.1 hypothetical protein -
  ND05_RS12405 - 2345765..2345977 (+) 213 WP_000935420.1 hypothetical protein -
  ND05_RS12410 - 2346010..2346227 (+) 218 Protein_2171 DUF4014 family protein -
  ND05_RS12415 - 2346229..2346492 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24130.97 Da        Isoelectric Point: 9.2180

>NTDB_id=276508 ND05_RS12265 WP_000841914.1 2325166..2325795(+) (sxy/tfoX) [Escherichia coli strain 2014C-3655]
MKSPSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=276508 ND05_RS12265 WP_000841914.1 2325166..2325795(+) (sxy/tfoX) [Escherichia coli strain 2014C-3655]
ATGAAAAGCCCCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995

Multiple sequence alignment