Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   C6N27_RS12860 Genome accession   NZ_CP027307
Coordinates   2316299..2316883 (-) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain 2015C-3108     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2302955..2328102 2316299..2316883 within 0


Gene organization within MGE regions


Location: 2302955..2328102
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C6N27_RS12795 - 2303885..2304937 (+) 1053 Protein_2377 3'-5' exoribonuclease -
  C6N27_RS29970 - 2305005..2305247 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  C6N27_RS12800 - 2305225..2306240 (+) 1016 Protein_2379 tyrosine-type recombinase/integrase -
  C6N27_RS12805 yccA 2306648..2307307 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  C6N27_RS12810 tusE 2307398..2307727 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  C6N27_RS12815 yccX 2307724..2308002 (-) 279 WP_000048244.1 acylphosphatase -
  C6N27_RS12820 rlmI 2308097..2309287 (+) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C6N27_RS12825 hspQ 2309345..2309662 (+) 318 WP_001295356.1 heat shock protein HspQ -
  C6N27_RS12830 yccU 2309707..2310120 (-) 414 WP_000665217.1 CoA-binding protein -
  C6N27_RS12835 yccT 2310293..2310955 (+) 663 WP_000847791.1 DUF2057 family protein -
  C6N27_RS12840 mgsA 2311051..2311509 (+) 459 WP_000424181.1 methylglyoxal synthase -
  C6N27_RS12845 helD 2311541..2313595 (-) 2055 WP_001297106.1 DNA helicase IV -
  C6N27_RS12850 yccF 2313718..2314164 (+) 447 WP_001261235.1 YccF domain-containing protein -
  C6N27_RS12855 yccS 2314174..2316336 (+) 2163 WP_000875023.1 YccS family putative transporter -
  C6N27_RS12860 sxy/tfoX 2316299..2316883 (-) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C6N27_RS12865 sulA 2317147..2317656 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  C6N27_RS12875 ompA 2318013..2319053 (+) 1041 WP_000750416.1 porin OmpA -
  C6N27_RS12880 matP 2319129..2319581 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C6N27_RS12885 ycbZ 2319767..2321527 (+) 1761 WP_000156528.1 Lon protease family protein -
  C6N27_RS12890 fabA 2321596..2322114 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C6N27_RS12895 rmf 2322184..2322351 (-) 168 WP_000828648.1 ribosome modulation factor -
  C6N27_RS12900 pqiC 2322607..2323170 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  C6N27_RS12905 pqiB 2323167..2324807 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  C6N27_RS12910 pqiA 2324812..2326065 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C6N27_RS12915 uup 2326195..2328102 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=276245 C6N27_RS12860 WP_077825616.1 2316299..2316883(-) (sxy/tfoX) [Escherichia coli strain 2015C-3108]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=276245 C6N27_RS12860 WP_077825616.1 2316299..2316883(-) (sxy/tfoX) [Escherichia coli strain 2015C-3108]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995


Multiple sequence alignment