Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4I21_RS06995 Genome accession   NZ_CP032479
Coordinates   1421371..1421484 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 21-F-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1416371..1426484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4I21_RS06975 - 1417039..1418451 (-) 1413 WP_139543446.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4I21_RS06980 comB10 1418522..1419658 (-) 1137 WP_139543447.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4I21_RS06985 comB9 1419651..1420631 (-) 981 WP_139543448.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4I21_RS06990 comB8 1420631..1421374 (-) 744 WP_001208388.1 virB8 family protein Machinery gene
  D4I21_RS06995 comB7 1421371..1421484 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4I21_RS07000 comB6 1421500..1422555 (-) 1056 WP_139543449.1 P-type conjugative transfer protein TrbL Machinery gene
  D4I21_RS07005 - 1422563..1423558 (-) 996 WP_139543450.1 PDZ domain-containing protein -
  D4I21_RS07010 - 1423558..1423859 (-) 302 Protein_1323 YbaB/EbfC family nucleoid-associated protein -
  D4I21_RS07015 panD 1423862..1424215 (-) 354 WP_139543451.1 aspartate 1-decarboxylase -
  D4I21_RS07020 - 1424205..1426430 (-) 2226 WP_139543452.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=276202 D4I21_RS06995 WP_001217873.1 1421371..1421484(-) (comB7) [Helicobacter pylori strain 21-F-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=276202 D4I21_RS06995 WP_001217873.1 1421371..1421484(-) (comB7) [Helicobacter pylori strain 21-F-EK1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1